ARF4L Antibody


Immunocytochemistry/ Immunofluorescence: ARF4L Antibody [NBP2-31820] - Immunofluorescent staining of human cell line SiHa shows localization to vesicles.
Immunohistochemistry-Paraffin: ARF4L Antibody [NBP2-31820] - Staining of human colon shows strong membranous positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ARF4L Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKT
Specificity of human ARF4L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARF4L Protein (NBP2-31820PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ARF4L Antibody

  • ADP-ribosylation factor 4-like
  • ADP-ribosylation factor-like 4D
  • ADP-ribosylation factor-like protein 4D
  • ADP-ribosylation factor-like protein 4L
  • ARF4LADP-ribosylation factor-like 6
  • ARL6


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB (-), WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Bv, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ca, Eq

Publications for ARF4L Antibody (NBP2-31820) (0)

There are no publications for ARF4L Antibody (NBP2-31820).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARF4L Antibody (NBP2-31820) (0)

There are no reviews for ARF4L Antibody (NBP2-31820). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARF4L Antibody (NBP2-31820) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ARF4L Products

Bioinformatics Tool for ARF4L Antibody (NBP2-31820)

Discover related pathways, diseases and genes to ARF4L Antibody (NBP2-31820). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARF4L Antibody (NBP2-31820)

Discover more about diseases related to ARF4L Antibody (NBP2-31820).

Pathways for ARF4L Antibody (NBP2-31820)

View related products by pathway.

PTMs for ARF4L Antibody (NBP2-31820)

Learn more about PTMs related to ARF4L Antibody (NBP2-31820).

Research Areas for ARF4L Antibody (NBP2-31820)

Find related products by research area.

Blogs on ARF4L

There are no specific blogs for ARF4L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARF4L Antibody and receive a gift card or discount.


Gene Symbol ARL4D