ARF4L Antibody

Images

 
Western Blot: ARF4L Antibody [H00000379-B01P] - Analysis of ARL4D expression in transfected 293T cell line by ARL4D polyclonal antibody. Lane 1: ARL4D transfected lysate(22.11 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ARF4L Antibody Summary

Immunogen
ARL4D (NP_001652.2, 1 a.a. - 201 a.a.) full-length human protein. MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ARL4D
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARF4L Antibody

  • ADP-ribosylation factor 4-like
  • ADP-ribosylation factor-like 4D
  • ADP-ribosylation factor-like protein 4D
  • ADP-ribosylation factor-like protein 4L
  • ARF4LADP-ribosylation factor-like 6
  • ARL6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-75457
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00009266-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-77198
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-13323
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88988
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88923
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91695
Species: Hu
Applications: IHC, IHC-P
NBP2-26147
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-46542
Species: Hu
Applications: WB, IHC
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
H00007071-M15
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-34951
Species: Hu
NBP1-90097
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22513
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-5663
Species: Hu, Mu, Bv, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq

Publications for ARF4L Antibody (H00000379-B01P) (0)

There are no publications for ARF4L Antibody (H00000379-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARF4L Antibody (H00000379-B01P) (0)

There are no reviews for ARF4L Antibody (H00000379-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARF4L Antibody (H00000379-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARF4L Products

Bioinformatics Tool for ARF4L Antibody (H00000379-B01P)

Discover related pathways, diseases and genes to ARF4L Antibody (H00000379-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARF4L Antibody (H00000379-B01P)

Discover more about diseases related to ARF4L Antibody (H00000379-B01P).
 

Pathways for ARF4L Antibody (H00000379-B01P)

View related products by pathway.

PTMs for ARF4L Antibody (H00000379-B01P)

Learn more about PTMs related to ARF4L Antibody (H00000379-B01P).
 

Research Areas for ARF4L Antibody (H00000379-B01P)

Find related products by research area.

Blogs on ARF4L

There are no specific blogs for ARF4L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARF4L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL4D
Uniprot