ARF1 Antibody (0C5B3)

Western Blot: ARF1 Antibody (0C5B3) [NBP3-16782] - Western blot analysis of extracts of various cell lines, using ARF1 Rabbit mAb (NBP3-16782) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunocytochemistry/ Immunofluorescence: ARF1 Antibody (0C5B3) [NBP3-16782] - Immunofluorescence analysis of NIH-3T3 cells using ARF1 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 0C5B3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

ARF1 Antibody (0C5B3) Summary

• Description: Novus Biologicals Rabbit ARF1 Antibody (0C5B3) (NBP3-16782) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human ARF1 (P84077). GQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ARF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ARF1 Antibody (0C5B3)

• ADP-ribosylation factor 1
• ARF1

Background

The ADP-ribosylation factor (Arf) family comprises a group of structurally and functionally conserved 21 kDa proteins, which are members of the Ras superfamily of regulatory GTP-binding proteins. Arf is involved in intracellular protein traffic to and within the Golgi complex. Arf has a number of disparate activities including maintenance of organelle integrity, assembly of coat proteins, as a co-factor for cholera toxin and as an activator of phospholipase D. The Arf family is divided functionally into the Arf and the Arf-like (Arl) proteins. Arfs share more than 60% sequence identity, appear to be ubiquitous in eukaryotes, and are highly conserved evolutionarily.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARF1