Aquaporin-10 Antibody

Immunohistochemistry-Paraffin: Aquaporin-10 Antibody [NBP2-49466] - Staining in human duodenum and liver tissues using anti-AQP10 antibody. Corresponding AQP10 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Aquaporin-10 Antibody [NBP2-49466] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: Aquaporin-10 Antibody [NBP2-49466] - Staining of human duodenum shows high expression.

Product Discontinued

Aquaporin-10 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AQP10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Aquaporin-10 Antibody

• AQP-10
• AQPA_HUMAN
• aquaglyceroporin-10
• aquaporin 10
• aquaporin-10
• Small intestine aquaporin

Background

The Aquaporin-10 gene encodes a member of the aquaglyceroporin family of integral membrane proteins. Members of this familyfunction as water-permeable channels in the epithelia of organs that absorb and excrete water. This protein was shownto function as a water-sele

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AQP10