APOO Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: APOO Antibody [NBP1-84746] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.

Analysis in human cell line TD47D.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

APOO Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APOO
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  APOO Protein (NBP1-84746PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (80%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for APOO Antibody - BSA Free

• apolipoprotein O
• FAM121Bbrain my025
• family with sequence similarity 121B
• MGC4825
• My025
• MYO25
• Protein FAM121B

Background

apolipoprotein O, also known as MYO25, FAM121B, MGC4825. Entrez Protein NP_077027. It is a chrondroitin-sulfate chain containing member of the apolipoprotein family and is an original glycoprotein up-regulated by diabetes in human Heart. Promotes cholesterol efflux from macrophage cells. Detected in HDL, LDL and VLDL. Secreted by a microsomal triglyceride transfer protein (MTTP)-dependent mechanism, probably as a VLDL-associated protein that is subsequently transferred to HDL. May be involved in myocardium-protective mechanisms against lipid accumulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APOO
• Entrez:
  • 79135(Human)
• Uniprot:
  • Q9BUR5(Human)