Recombinant Human Apolipoprotein L1 Protein

Images

 
Recombinant Human Apolipoprotein L1 Protein [H00008542-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Apolipoprotein L1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-238 of Human APOL1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTMDPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFTEGGSLVLLEPGMELGITAALTGITSSTMDYGKKWWTQA

Protein/Peptide Type
Recombinant Protein
Gene
APOL1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Apolipoprotein L1 Protein

  • APOL
  • APO-L
  • APOL-I
  • Apolipoprotein L
  • apolipoprotein L, 1
  • apolipoprotein L1
  • Apolipoprotein L-I
  • FSGS4

Background

Apolipoprotein A-I is a relatively abundant plasma protein and is the major apoprotein of HDL. It is involved in the formation of most cholesteryl esters in plasma and also promotes efflux of cholesterol from cells. The protein encoded by this gene is a secreted high density lipoprotein which binds to apolipoprotein A-I. This apolipoprotein L family member may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31733
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-51595
Species: Hu
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01367
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-00092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-Fr, PLA
NB100-2270
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF4409
Species: Mu
Applications: WB
NBP1-89818
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90127
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA

Publications for Apolipoprotein L1 Recombinant Protein (H00008542-P01) (0)

There are no publications for Apolipoprotein L1 Recombinant Protein (H00008542-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein L1 Recombinant Protein (H00008542-P01) (0)

There are no reviews for Apolipoprotein L1 Recombinant Protein (H00008542-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein L1 Recombinant Protein (H00008542-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apolipoprotein L1 Products

Bioinformatics Tool for Apolipoprotein L1 Recombinant Protein (H00008542-P01)

Discover related pathways, diseases and genes to Apolipoprotein L1 Recombinant Protein (H00008542-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein L1 Recombinant Protein (H00008542-P01)

Discover more about diseases related to Apolipoprotein L1 Recombinant Protein (H00008542-P01).
 

Pathways for Apolipoprotein L1 Recombinant Protein (H00008542-P01)

View related products by pathway.

PTMs for Apolipoprotein L1 Recombinant Protein (H00008542-P01)

Learn more about PTMs related to Apolipoprotein L1 Recombinant Protein (H00008542-P01).

Blogs on Apolipoprotein L1

There are no specific blogs for Apolipoprotein L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATG5 Antibody
NB110-53818
Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Apolipoprotein L1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APOL1