Apolipoprotein CIII Antibody - BSA Free

Western Blot: Apolipoprotein CIII Antibody [NBP2-87015] - Host: Rabbit. Target Name: APOC3. Sample Tissue: Human MCF7 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Apolipoprotein CIII Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Apolipoprotein CIII Antibody - BSA Free (NBP2-87015) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Apolipoprotein CIII. Peptide sequence: MQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APOC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Apolipoprotein CIII Antibody - BSA Free

• APOC3
• APOCIII
• apo-CIII
• apoC-III
• Apolipoprotein C3
• apolipoprotein C-III
• MGC150353

Background

At least 9 distinct polymorphic forms of apolipoproteins are known. The apolipoproteins act as stabilizers of the intact lipoprotein particles. Quantitative measurements of HDL, LDL and VLDL particles in human serum are often used to estimate an individuals' relative risk of coronary heart disease. In addition, quantitative immunological measurements of certain apolipoproteins (especially A-1 and B) have been suggested to be more accurate estimators of coronary heart disease than measurements of lipoprotein particles (especially HDL and LDL). This apo-lipoprotein antibody is derived from human plasma by density gradient ultracentrifugation and HPLC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APOC3