Apolipoprotein C4 Antibody

Images

 
Western Blot: Apolipoprotein C4 Antibody [H00000346-B01P] - Analysis of APOC4 expression in transfected 293T cell line by APOC4 polyclonal antibody. Lane1:APOC4 transfected lysate(13.97 KDa). Lane2:Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Apolipoprotein C4 Antibody Summary

Immunogen
APOC4 (NP_001637.1, 1 a.a. - 127 a.a.) full-length human protein. MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
APOC4
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Apolipoprotein C4 Antibody

  • APOC4
  • apo-CIV
  • apoC-IV
  • Apolipoprotein C4
  • apolipoprotein C-IV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4497
Species: Hu
Applications: WB, Simple Western
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000341-M01
Species: Hu
Applications: WB, ELISA
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
AF4647
Species: Hu
Applications: WB, IHC, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-90274
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1915
Species: Hu, Mu, Rt, Ha, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
H00000346-B01P
Species: Hu
Applications: WB

Publications for Apolipoprotein C4 Antibody (H00000346-B01P) (0)

There are no publications for Apolipoprotein C4 Antibody (H00000346-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein C4 Antibody (H00000346-B01P) (0)

There are no reviews for Apolipoprotein C4 Antibody (H00000346-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein C4 Antibody (H00000346-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apolipoprotein C4 Products

Bioinformatics Tool for Apolipoprotein C4 Antibody (H00000346-B01P)

Discover related pathways, diseases and genes to Apolipoprotein C4 Antibody (H00000346-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein C4 Antibody (H00000346-B01P)

Discover more about diseases related to Apolipoprotein C4 Antibody (H00000346-B01P).
 

Pathways for Apolipoprotein C4 Antibody (H00000346-B01P)

View related products by pathway.

PTMs for Apolipoprotein C4 Antibody (H00000346-B01P)

Learn more about PTMs related to Apolipoprotein C4 Antibody (H00000346-B01P).

Blogs on Apolipoprotein C4

There are no specific blogs for Apolipoprotein C4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apolipoprotein C4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOC4
Uniprot