Apolipoprotein C4 Antibody - Azide and BSA Free Summary
Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen |
APOC4 (NP_001637.1, 1 a.a. - 127 a.a.) full-length human protein. MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
APOC4 |
Purity |
Protein G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
It has been used for WB and Functional. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Apolipoprotein C4 Antibody - Azide and BSA Free
Background
Apolipoprotein (apo)C4 gene is a member of the apolipoprotein gene family. It is expressed in the liver and has a predicted protein structure characteristic of the other genes in this family. Apo C4 is a 3.3-kb gene consisting of 3 exons and 2 introns; it is located 0.5 kb 5' to the APOC2 gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ch(-), Hu, Mu(-), Pm, Rt(-)
Applications: Flow-IC, Flow, ICC/IF
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for Apolipoprotein C4 Antibody (H00000346-B01P) (0)
There are no publications for Apolipoprotein C4 Antibody (H00000346-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Apolipoprotein C4 Antibody (H00000346-B01P) (0)
There are no reviews for Apolipoprotein C4 Antibody (H00000346-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Apolipoprotein C4 Antibody (H00000346-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Apolipoprotein C4 Products
Blogs on Apolipoprotein C4