APOL3 Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

APOL3 Partial Recombinant Protein Summary

Description
APOL3 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: VEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRG
Preparation
Method
in vitro wheat germ expression system
Gene
APOL3

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for APOL3 Partial Recombinant Protein

  • APOLIII
  • apoL-III
  • apolipoprotein L, 3
  • apolipoprotein L3
  • Apolipoprotein L-III
  • CG12_1
  • CG121
  • CG12-1
  • TNF-inducible protein CG12-1

Background

APOL3 - apolipoprotein L, 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89033
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-17052
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-90127
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56183
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
AF4764
Species: Hu
Applications: WB, IHC, ICC
NBP2-45788
Species: Hu
Applications: WB, IHC
NB120-6586
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-14302
Species: Hu
Applications: IHC, IHC-P
NBP1-83699
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14358
Species: Hu
Applications: IHC, IHC-P
H00080833-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for APOL3 Partial Recombinant Protein (H00080833-Q01) (0)

There are no publications for APOL3 Partial Recombinant Protein (H00080833-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOL3 Partial Recombinant Protein (H00080833-Q01) (0)

There are no reviews for APOL3 Partial Recombinant Protein (H00080833-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APOL3 Partial Recombinant Protein (H00080833-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional APOL3 Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for APOL3 Partial Recombinant Protein (H00080833-Q01)

Discover related pathways, diseases and genes to APOL3 Partial Recombinant Protein (H00080833-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOL3 Partial Recombinant Protein (H00080833-Q01)

Discover more about diseases related to APOL3 Partial Recombinant Protein (H00080833-Q01).
 

Pathways for APOL3 Partial Recombinant Protein (H00080833-Q01)

View related products by pathway.

Research Areas for APOL3 Partial Recombinant Protein (H00080833-Q01)

Find related products by research area.

Blogs on APOL3

There are no specific blogs for APOL3, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol APOL3

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00080833-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

APOL3 Recombinant Protein
H00080833-P01-10ug
APOL3 Antibody
NBP1-06979