Recombinant Human APOL3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human APOL3 Protein Summary

Description
APOL3 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: VEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRG
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
APOL3

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human APOL3 Protein

  • APOLIII
  • apoL-III
  • apolipoprotein L, 3
  • apolipoprotein L3
  • Apolipoprotein L-III
  • CG12_1
  • CG121
  • CG12-1
  • TNF-inducible protein CG12-1

Background

APOL3 - apolipoprotein L, 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89033
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-17052
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-90127
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4764
Species: Hu
Applications: WB, IHC, ICC
NBP2-45788
Species: Hu
Applications: WB, IHC
NB120-6586
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-14302
Species: Hu
Applications: IHC, IHC-P
NBP1-83699
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14358
Species: Hu
Applications: IHC, IHC-P

Publications for APOL3 Partial Recombinant Protein (H00080833-Q01) (0)

There are no publications for APOL3 Partial Recombinant Protein (H00080833-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOL3 Partial Recombinant Protein (H00080833-Q01) (0)

There are no reviews for APOL3 Partial Recombinant Protein (H00080833-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APOL3 Partial Recombinant Protein (H00080833-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human APOL3 Protein Products

Related Products by Gene

Bioinformatics Tool for APOL3 Partial Recombinant Protein (H00080833-Q01)

Discover related pathways, diseases and genes to APOL3 Partial Recombinant Protein (H00080833-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOL3 Partial Recombinant Protein (H00080833-Q01)

Discover more about diseases related to APOL3 Partial Recombinant Protein (H00080833-Q01).
 

Pathways for APOL3 Partial Recombinant Protein (H00080833-Q01)

View related products by pathway.

Research Areas for APOL3 Partial Recombinant Protein (H00080833-Q01)

Find related products by research area.

Blogs on APOL3

There are no specific blogs for APOL3, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Recombinant Human APOL3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APOL3

Customers Who Bought This Also Bought

APOL3 Antibody
NBP1-06979