Recombinant Human APLP-2 Protein

Images

 
SDS-Page: Recombinant Human APLP-2 Protein [H00000334-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human APLP-2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 41-150 of Human APLP-2

Source: Wheat Germ

Amino Acid Sequence: AGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVGEFVSDVLLVPEKCQ

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
APLP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human APLP-2 Protein

  • amyloid beta (A4) precursor-like protein 2
  • amyloid precursor protein homolog HSD-2
  • Amyloid protein homolog
  • amyloid-like protein 2
  • APLP2
  • APLP-2
  • APPH
  • APPHCDEI box-binding protein
  • APPL2
  • CDEBP
  • WALPLP2
  • YWK-II

Background

APLP2 - amyloid beta (A4) precursor-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-89036
Species: Hu
Applications: WB, IHC, IHC-P
NB110-58360
Species: Hu, Mu, Rt
Applications: WB, IP
MAB7075
Species: Hu
Applications: WB
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NB120-13253
Species: Hu, Mu, Bv, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-41182
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP1-89330
Species: Hu
Applications: IHC, IHC-P
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59744
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-Fr
NBP1-84700
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-62539
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Sh
Applications: WB
H00000334-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for APLP-2 Partial Recombinant Protein (H00000334-Q01) (0)

There are no publications for APLP-2 Partial Recombinant Protein (H00000334-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APLP-2 Partial Recombinant Protein (H00000334-Q01) (0)

There are no reviews for APLP-2 Partial Recombinant Protein (H00000334-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APLP-2 Partial Recombinant Protein (H00000334-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional APLP-2 Products

Bioinformatics Tool for APLP-2 Partial Recombinant Protein (H00000334-Q01)

Discover related pathways, diseases and genes to APLP-2 Partial Recombinant Protein (H00000334-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APLP-2 Partial Recombinant Protein (H00000334-Q01)

Discover more about diseases related to APLP-2 Partial Recombinant Protein (H00000334-Q01).
 

Pathways for APLP-2 Partial Recombinant Protein (H00000334-Q01)

View related products by pathway.

PTMs for APLP-2 Partial Recombinant Protein (H00000334-Q01)

Learn more about PTMs related to APLP-2 Partial Recombinant Protein (H00000334-Q01).
 

Research Areas for APLP-2 Partial Recombinant Protein (H00000334-Q01)

Find related products by research area.

Blogs on APLP-2

There are no specific blogs for APLP-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human APLP-2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APLP2