APLP-1 Antibody

Images

 
Western Blot: APLP1 Antibody [NBP1-89036] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: APLP-1 Antibody [NBP1-89036] - Staining of human hippocampus shows strong cytoplasmic and nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: APLP1 Antibody [NBP1-89036] - Staining of human hippocampus shows strong positivity in subsets of neuronal cells and neuropil.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APLP-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GTAVGDPSTRSWPPGSRVEGAEDEEEEESFPQPVDDYFVEPPQAEEEEETVPPPSSHTLAVVGKVTPTPRPTDGVDIYFGMPGEISEHEGFLRAKMDLEERRMRQINEVMREWAMADNQSK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APLP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
APLP-1 Protein (NBP1-89036PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APLP-1 Antibody

  • amyloid beta (A4) precursor-like protein 1
  • amyloid precursor-like protein 1
  • amyloid-like protein 1
  • APLP1
  • APLP-1
  • APLPAPLP-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89029
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB110-58360
Species: Hu, Mu, Rt
Applications: WB, IP
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-62539
Species: Hu
Applications: WB
MAB7075
Species: Hu
Applications: WB
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-84700
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-89036
Species: Hu
Applications: WB, IHC, IHC-P

Publications for APLP-1 Antibody (NBP1-89036) (0)

There are no publications for APLP-1 Antibody (NBP1-89036).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APLP-1 Antibody (NBP1-89036) (0)

There are no reviews for APLP-1 Antibody (NBP1-89036). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APLP-1 Antibody (NBP1-89036) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APLP-1 Products

Bioinformatics Tool for APLP-1 Antibody (NBP1-89036)

Discover related pathways, diseases and genes to APLP-1 Antibody (NBP1-89036). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APLP-1 Antibody (NBP1-89036)

Discover more about diseases related to APLP-1 Antibody (NBP1-89036).
 

Pathways for APLP-1 Antibody (NBP1-89036)

View related products by pathway.

PTMs for APLP-1 Antibody (NBP1-89036)

Learn more about PTMs related to APLP-1 Antibody (NBP1-89036).
 

Research Areas for APLP-1 Antibody (NBP1-89036)

Find related products by research area.

Blogs on APLP-1

There are no specific blogs for APLP-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APLP-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APLP1
Entrez