Apc5 Antibody

Images

 
Western Blot: Apc5 Antibody [NBP1-90136] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Apc5 Antibody [NBP1-90136] - Staining of human fallopian tube shows nuclear membrane positivity in glandular cells.
Western Blot: Apc5 Antibody [NBP1-90136] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Apc5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANAPC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Apc5 Protein (NBP1-90136PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Apc5 Antibody

  • anaphase promoting complex subunit 5
  • anaphase-promoting complex subunit 5
  • APC5Cyclosome subunit 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77157
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-77375
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57669
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-01128
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4497
Species: Hu
Applications: WB, Simple Western
NBP1-90137
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20389
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77155
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77376
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-13286
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-40367
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-59068
Species: Hu
Applications: WB
NBP1-90136
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Apc5 Antibody (NBP1-90136) (0)

There are no publications for Apc5 Antibody (NBP1-90136).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apc5 Antibody (NBP1-90136) (0)

There are no reviews for Apc5 Antibody (NBP1-90136). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apc5 Antibody (NBP1-90136) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apc5 Products

Bioinformatics Tool for Apc5 Antibody (NBP1-90136)

Discover related pathways, diseases and genes to Apc5 Antibody (NBP1-90136). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apc5 Antibody (NBP1-90136)

Discover more about diseases related to Apc5 Antibody (NBP1-90136).
 

Pathways for Apc5 Antibody (NBP1-90136)

View related products by pathway.

Research Areas for Apc5 Antibody (NBP1-90136)

Find related products by research area.

Blogs on Apc5

There are no specific blogs for Apc5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apc5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANAPC5