Apc5 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Apc5 Antibody - BSA Free (NBP1-77154) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Antibody was raised against a 17 amino acid synthetic peptide near the center of human APC5. The immunogen is located within amino acids 480 - 530 of APC5. Amino Acid Squence: LKHLKERFPPNSQHAQL |
| Predicted Species |
Chicken (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ANAPC5 |
| Purity |
Peptide affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA 1:100-1:2000
- Immunocytochemistry/ Immunofluorescence 20 ug/ml
- Immunohistochemistry 5 ug/ml
- Immunohistochemistry-Paraffin 5 ug/ml
- Western Blot 1-2 ug/ml
|
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS |
| Preservative |
0.02% Sodium Azide |
| Concentration |
1 mg/ml |
| Purity |
Peptide affinity purified |
Alternate Names for Apc5 Antibody - BSA Free
Background
Cell cycle regulated protein ubiquitination and degradation within subcellular domains is thought to be essential for the normal progression of mitosis. APC5 is a highly conserved component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. APC/C is responsible for degrading anaphase inhibitors, mitotic cyclins, and spindle-associated proteins ensuring that events of mitosis take place in proper sequence. The individual APC/C components mRNA and protein levels are expressed at approximately the same levels in most tissues and cell lines, suggesting that they perform their functions as part of a complex. While little is known of APC5, it is thought that APC5 associates with other APC/C components APC1, APC4, and CDC23 interdependently, such that loss of any one subunit reduces binding between the remaining three.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IP, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ch
Applications: WB, ELISA, ICC/IF, IHC
Publications for Apc5 Antibody (NBP1-77154) (0)
There are no publications for Apc5 Antibody (NBP1-77154).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Apc5 Antibody (NBP1-77154) (0)
There are no reviews for Apc5 Antibody (NBP1-77154).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Apc5 Antibody (NBP1-77154). (Showing 1 - 1 of 1 FAQ).
-
I'm interested in your anti-ANAPC5 (NBP1-77154). Is the 17 aa sequence proprietary? If so, could you help me by performing a BLASTp of the recognized epitope and the bovine ANAPC5 (uniron E1BK11) and send me the results as % max ident, please? What would be your recommendation about using your Ab to detect the bovine ANAPC5?
- It looks like the sequence location of this one has 100% identity with the Bovine sequence available on UniProt. I would think this would be a good choice for you. The reason I have selected this one is because we haven't tested any of our antibodies against this target in ICC/IF, but it has been shown to stain tissues so there is a good chance it can stain cells as well. NBP1-90136: LSQQASLLKNDETKALTPASLQKELNNLLK FNPDFAEAHYLSYLNNLRVQDVFSSTHSLL HYFDRLILTGAESKSNGEEGYGRSLR I would recommend taking advantage of our Innovators Reward Program. Our Innovator's Reward Program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure.
Secondary Antibodies
| |
Isotype Controls
|
Additional Apc5 Products
Research Areas for Apc5 Antibody (NBP1-77154)
Find related products by research area.
|
Blogs on Apc5