Apc5 Antibody

Images

 
Western Blot: Apc5 Antibody [NBP1-77154] - Human kidney tissue lysate with APC5 antibody at (A) 1 and (B) 2 ug/mL.
Immunocytochemistry/ Immunofluorescence: Apc5 Antibody [NBP1-77154] - Immunofluorescence of APC5 in rat kidney tissue with APC5 antibody at 20 ug/mL.
Immunohistochemistry-Paraffin: Apc5 Antibody [NBP1-77154] - Rat kidney tissue with APC5 antibody at 5 ug/mL.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
1 mg/ml

Order Details

Apc5 Antibody Summary

Immunogen
Antibody was raised against a 17 amino acid synthetic peptide near the center of human APC5. The immunogen is located within amino acids 480 - 530 of APC5.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANAPC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 20 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Control Peptide
Apc5 Peptide (NBP1-77154PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS
Preservative
0.02% Sodium Azide
Concentration
1 mg/ml
Purity
Immunogen affinity purified

Alternate Names for Apc5 Antibody

  • anaphase promoting complex subunit 5
  • anaphase-promoting complex subunit 5
  • APC5Cyclosome subunit 5

Background

Cell cycle regulated protein ubiquitination and degradation within subcellular domains is thought to be essential for the normal progression of mitosis. APC5 is a highly conserved component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. APC/C is responsible for degrading anaphase inhibitors, mitotic cyclins, and spindle-associated proteins ensuring that events of mitosis take place in proper sequence. The individual APC/C components mRNA and protein levels are expressed at approximately the same levels in most tissues and cell lines, suggesting that they perform their functions as part of a complex. While little is known of APC5, it is thought that APC5 associates with other APC/C components APC1, APC4, and CDC23 interdependently, such that loss of any one subunit reduces binding between the remaining three.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77157
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-77375
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57669
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-01128
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4497
Species: Hu
Applications: WB, Simple Western
NBP1-90137
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20389
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77155
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77376
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-13286
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-40367
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-59068
Species: Hu
Applications: WB
NBP1-77154
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Apc5 Antibody (NBP1-77154) (0)

There are no publications for Apc5 Antibody (NBP1-77154).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apc5 Antibody (NBP1-77154) (0)

There are no reviews for Apc5 Antibody (NBP1-77154). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Apc5 Antibody (NBP1-77154). (Showing 1 - 1 of 1 FAQ).

  1. I'm interested in your anti-ANAPC5 (NBP1-77154). Is the 17 aa sequence proprietary? If so, could you help me by performing a BLASTp of the recognized epitope and the bovine ANAPC5 (uniron E1BK11) and send me the results as % max ident, please? What would be your recommendation about using your Ab to detect the bovine ANAPC5?
    • It looks like the sequence location of this one has 100% identity with the Bovine sequence available on UniProt. I would think this would be a good choice for you. The reason I have selected this one is because we haven't tested any of our antibodies against this target in ICC/IF, but it has been shown to stain tissues so there is a good chance it can stain cells as well. NBP1-90136: LSQQASLLKNDETKALTPASLQKELNNLLK FNPDFAEAHYLSYLNNLRVQDVFSSTHSLL HYFDRLILTGAESKSNGEEGYGRSLR I would recommend taking advantage of our Innovators Reward Program. Our Innovator's Reward Program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure.

Secondary Antibodies

 

Isotype Controls

Additional Apc5 Products

Bioinformatics Tool for Apc5 Antibody (NBP1-77154)

Discover related pathways, diseases and genes to Apc5 Antibody (NBP1-77154). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apc5 Antibody (NBP1-77154)

Discover more about diseases related to Apc5 Antibody (NBP1-77154).
 

Pathways for Apc5 Antibody (NBP1-77154)

View related products by pathway.

Research Areas for Apc5 Antibody (NBP1-77154)

Find related products by research area.

Blogs on Apc5

There are no specific blogs for Apc5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apc5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANAPC5
Uniprot