Apc1 Antibody

Images

 
Western Blot: Apc1 Antibody [NBP1-90141] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HELA
Immunohistochemistry-Paraffin: Apc1 Antibody [NBP1-90141] - Staining of human thyroid gland shows distinct cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Apc1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANAPC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000 - 1:2500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Apc1 Protein (NBP1-90141PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Apc1 Antibody

  • anaphase promoting complex subunit 1
  • anaphase-promoting complex 1 (meiotic checkpoint regulator)
  • anaphase-promoting complex subunit 1
  • APC1Testis-specific gene 24 protein
  • Cyclosome subunit 1
  • Mitotic checkpoint regulator
  • TSG24MCPR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-77376
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-01128
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4497
Species: Hu
Applications: WB, Simple Western
NBP2-20389
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77155
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77157
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-89093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-45493
Species: Hu, Mk
Applications: WB, IHC, IF
NBP2-56924
Species: Hu
Applications: ICC/IF
AF1620
Species: Mu
Applications: WB, IHC
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90136
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Apc1 Antibody (NBP1-90141) (0)

There are no publications for Apc1 Antibody (NBP1-90141).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apc1 Antibody (NBP1-90141) (0)

There are no reviews for Apc1 Antibody (NBP1-90141). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apc1 Antibody (NBP1-90141) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apc1 Products

Apc1 NBP1-90141

Bioinformatics Tool for Apc1 Antibody (NBP1-90141)

Discover related pathways, diseases and genes to Apc1 Antibody (NBP1-90141). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apc1 Antibody (NBP1-90141)

Discover more about diseases related to Apc1 Antibody (NBP1-90141).
 

Pathways for Apc1 Antibody (NBP1-90141)

View related products by pathway.

PTMs for Apc1 Antibody (NBP1-90141)

Learn more about PTMs related to Apc1 Antibody (NBP1-90141).
 

Research Areas for Apc1 Antibody (NBP1-90141)

Find related products by research area.

Blogs on Apc1

There are no specific blogs for Apc1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apc1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANAPC1