AP4M1 Antibody - BSA Free

Immunohistochemistry: AP4M1 Antibody [NBP2-56456] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AP4M1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AP4M1 Antibody - BSA Free (NBP2-56456) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFES
• Predicted Species: Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AP4M1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  AP4M1 Recombinant Protein Antigen (NBP2-56456PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AP4M1 Antibody - BSA Free

• Adapter-related protein complex 4 mu-1 subunit
• adaptor-related protein complex 4, mu 1 subunit
• adaptor-related protein complex AP-4 mu4 subunit
• AP-4 adapter complex mu subunit
• AP-4 complex subunit mu-1
• CPSQ3
• Mu subunit of AP-4
• mu4
• MU-4
• mu4-adaptin
• Mu-adaptin-related protein 2
• mu-adaptin-related protein-2
• MUARP2
• MU-ARP2

Background

The AP4M1 gene encodes a subunit of the heterotetrameric AP-4 complex. The encoded protein belongs to the adaptor complexesmedium subunits family. This AP-4 complex is involved in the recognition and sorting of cargo proteins withtyrosine-based motifs from the

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP4M1