Recombinant Human AP3M2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AP3M2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-418 of Human AP3M2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIIDKSGSTITAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLLSYHVSAQNLVAIPVYVKHNISFRDSSSLGRFEITVGPKQTMGKTIEGVTVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMSLQAGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
AP3M2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AP3M2 Protein

  • Adapter-related protein complex 3 mu-2 subunit
  • adaptor-related protein complex 3, mu 2 subunit
  • AP-3 complex subunit mu-2
  • AP47B
  • CLA20
  • Clathrin assembly protein assembly protein complex 1 medium chain homolog 2
  • Clathrin coat assembly protein AP47 homolog 2
  • Clathrin coat-associated protein AP47 homolog 2
  • clathrin-associated protein AP47 homolog 2
  • Golgi adaptor AP-1 47 kDa protein homolog 2
  • HA1 47 kDa subunit homolog 2
  • HA1 47kDA subunit homolog 2
  • mu3B-adaptin
  • P47B

Background

This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 3 (AP-3), which belongs to the adaptor complexes medium subunits family. The AP-3 complex plays a role in protein trafficking to lysosomes and specialized organelles. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55000
Species: Hu
Applications: ICC/IF
NBP2-00834
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-91674
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB342
Species: Hu
Applications: WB, AgAct
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for AP3M2 Recombinant Protein (H00010947-P01) (0)

There are no publications for AP3M2 Recombinant Protein (H00010947-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP3M2 Recombinant Protein (H00010947-P01) (0)

There are no reviews for AP3M2 Recombinant Protein (H00010947-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AP3M2 Recombinant Protein (H00010947-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AP3M2 Products

Bioinformatics Tool for AP3M2 Recombinant Protein (H00010947-P01)

Discover related pathways, diseases and genes to AP3M2 Recombinant Protein (H00010947-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP3M2 Recombinant Protein (H00010947-P01)

Discover more about diseases related to AP3M2 Recombinant Protein (H00010947-P01).
 

Pathways for AP3M2 Recombinant Protein (H00010947-P01)

View related products by pathway.

PTMs for AP3M2 Recombinant Protein (H00010947-P01)

Learn more about PTMs related to AP3M2 Recombinant Protein (H00010947-P01).

Blogs on AP3M2

There are no specific blogs for AP3M2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

AP3M2 Antibody
21070002-0.1mg
IL-2 [Unconjugated]
202-IL-010/CF
TGN46 Antibody
NBP1-49643

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AP3M2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AP3M2