Home » AP3B1 » AP3B1 Antibodies » AP3B1 Antibody

AP3B1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: AP3B1 Antibody [NBP1-89228] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunocytochemistry/ Immunofluorescence: AP3B1 Antibody [NBP1-89228] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: AP3B1 Antibody [NBP1-89228] - Staining of human rectum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

AP3B1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VISVSTPAFVPTKTHVLLHRMSGKGLAAHYFFPRQPCIFGDKMVSIQITLNNTTDRKIENIHIGEKKLPIGMKMHVFNPIDSLEPEGS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AP3B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AP3B1 Protein (NBP1-89228PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AP3B1 Antibody

  • Adapter-related protein complex 3 subunit beta-1
  • Adaptor protein complex AP-3 subunit beta-1
  • adaptor-related protein complex 3, beta 1 subunit
  • ADTB3
  • ADTB3APE
  • AP-3 complex subunit beta-1
  • beta-3A-adaptin
  • beta3A-adaptin
  • Clathrin assembly protein complex 3 beta-1 large chain
  • HPS
  • HPS2AP-3 complex beta-3A subunit

Background

AP3B1 encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. The encoded protein is part of the heterotetrameric AP-3 protein complex which interacts with the scaffolding protein clathrin. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 2. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-Page: Recombinant Human PRH2 Protein [H00005555-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Pallidin Antibody
(OTI1H9)
NBP2-01763
Western Blot: Pallidin Antibody (1H9) [NBP2-01763] Analysis of extracts (35ug) from 9 different cell lines by using anti-Pallidin monoclonal antibody.
Flow Cytometry: Pallidin Antibody (1H9) [NBP2-01763] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Pallidin antibody, and then analyzed by flow cytometry.
Immunohistochemistry-Paraffin: Pallidin Antibody (1H9) [NBP2-01763] - Staining of paraffin-embedded Human tonsil using anti-Pallidin mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Adenocarcinoma of breast using anti-Pancreatic Amylase mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Adenocarcinoma of ovary using anti-Pancreatic Amylase mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Carcinoma of kidney using anti-Pancreatic Amylase mouse monoclonal antibody.
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
EPB42 Antibody
(2G12)
H00002038-M01
Western Blot: EPB42 Antibody (2G12) [H00002038-M01] - Analysis of EPB42 expression in transfected 293T cell line by EPB42 monoclonal antibody (M01), clone 2G12.Lane 1: EPB42 transfected lysate(69.5 KDa).Lane 2: Non-transfected lysate.
ELISA: EPB42 Antibody (2G12) [H00002038-M01] - Detection limit for recombinant GST tagged EPB42 is 1 ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: EPB42 Antibody (2G12) [H00002038-M01] - Analysis of monoclonal antibody to EPB42 on HeLa cell . Antibody concentration 10 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, WB
Recombinant Human
PRH1 His Protein
NBP2-23368
SDS-Page: PRH1 Protein [NBP2-23368]
Species: Hu
Applications: PAGE
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(738 Publications)
Species: Hu
Applications: BA
PLA2G1B Antibody
(630823)
MAB5018
Western blot shows lysates of human pancreas tissue. PVDF Membrane was probed with 2 µg/mL of Human PLA2G1B Monoclonal Antibody (Catalog # MAB5018) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for PLA2G1B at approximately 17 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: IP, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(3 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
IL-6 [HRP]
D6050
(693 Publications)
Species: Hu
Applications: ELISA
Phospholipase B1
Antibody
H00151056-B01P
Western Blot: Phospholipase B1 Antibody [H00151056-B01P] - Analysis of PLB1 expression in transfected 293T cell line by PLB1 polyclonal antibody. Lane 1: PLB1 transfected lysate(46.53 KDa). Lane 2: Non-transfected lysate.
(1 Publication)
Species: Hu, Mu
Applications: WB
Placental
Lactogen/CSH1 Antibod ...
NBP2-46376
Immunohistochemistry: Placental Lactogen/CSH1 Antibody (2G4) [NBP2-46376] - Analysis of Human breast tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: Placental Lactogen/CSH1 Antibody (2G4) [NBP2-46376] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: Placental Lactogen/CSH1 Antibody (2G4) [NBP2-46376] - Analysis of Human Kidney tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu
Applications: IHC, WB
14-3-3 zeta
Antibody (818515) [Un ...
MAB2669
Simple Western lane view shows lysates of SH‑SY5Y human neuroblastoma cell line, loaded at 0.5 mg/mL. A specific band was detected for 14‑3‑3 zeta at approximately 34 kDa (as indicated) using 2 µg/mL of Mouse Anti-Human 14‑3‑3 zeta Monoclonal Antibody (Catalog # MAB2669). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of SH‑SY5Y human neuroblastoma cell line,SK‑Mel‑28 human malignant melanoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, and C6 rat glioma cell line. PVDF membrane was probed with 0.2 µg/mL of Mouse Anti-Human14‑3‑3 zeta  Monoclonal Antibody (Catalog # MAB2669) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for14‑3‑3 zeta at approximately 27 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
14‑3‑3 zeta  was detected in immersion fixed paraffin-embedded sections of human squamous cell carcinoma using Mouse Anti-Human 14‑3‑3 zeta Monoclonal Antibody (Catalog # MAB2669) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei and plasma membrane. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
Species: Hu
Applications: IHC, Simple Western, WB
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Publications)
Species: Hu
Applications: BA
Pancreatic Lipase
Antibody
NBP2-38958
Immunohistochemistry-Paraffin: Pancreatic Lipase Antibody [NBP2-38958] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: Pancreatic Lipase Antibody [NBP2-38958] - Staining in human pancreas and tonsil tissues using anti-PNLIP antibody. Corresponding PNLIP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Pancreatic Lipase Antibody [NBP2-38958] - Staining of human colon, kidney, liver and pancreas using Anti-PNLIP antibody NBP2-38958 (A) shows similar protein distribution across tissues to independent antibody NBP2-38962 (B).
Species: Hu
Applications: IHC, IHC-P
HOXA10 Antibody
NBP3-04877
Western Blot: HOXA10 Antibody [NBP3-04877] - Analysis of extracts of Mouse kidney, using HOxA10 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit
Western Blot: HOXA10 Antibody [NBP3-04877] - Analysis of extracts of various cell lines, using HOxA10 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Species: Hu, Mu, Rt
Applications: WB
Neutrophil
Elastase/ELA2 Antibod ...
MAB9167
Western Blot: Neutrophil Elastase/ELA2 Antibody (950334) - Azide and BSA Free [MAB9167] - Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - Analysis of human bone marrow tissue lysate with 0.5 ug/ml of hELA-2 Monoclonal Antibody followed by HRP-conjugated Anti-Mouse IgG Antibody. A specific band was detected for hELA-2 at approximately 25-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Immunohistochemistry: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - ELA-2 was detected in immersion fixed paraffin-embedded sections of human lymphoma using ELA-2 Monoclonal Antibody at 5 ug/ml. Tissue was stained using Mouse IgG VisUCyte HRP Polymer Antibody (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neutrophils .
Flow Cytometry: Neutrophil Elastase/ELA2 Antibody (950334) - Azide Free [MAB9167] - THP-1 human acute monocytic leukemia cell line treated with 3 uM monensin for 3 hours was stained with Mouse Anti-Human Neutrophil Elastase/ELA2 Monoclonal Antibody (Catalog # MAB9167, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005).
(1 Review)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in mouse kidney using DAB with hematoxylin counterstain.
Western Blot: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in human kidney lysate.
Immunohistochemistry-Paraffin: Serpin A8/Angiotensinogen Antibody - BSA Free [NBP1-30027] - Analysis of a FFPE tissue section of human placenta using 1:200 dilution of Serpin A8 (NBP1-30027) antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB

Publications for AP3B1 Antibody (NBP1-89228) (0)

There are no publications for AP3B1 Antibody (NBP1-89228).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP3B1 Antibody (NBP1-89228) (0)

There are no reviews for AP3B1 Antibody (NBP1-89228). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AP3B1 Antibody (NBP1-89228) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AP3B1 Products

Bioinformatics Tool for AP3B1 Antibody (NBP1-89228)

Discover related pathways, diseases and genes to AP3B1 Antibody (NBP1-89228). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP3B1 Antibody (NBP1-89228)

Discover more about diseases related to AP3B1 Antibody (NBP1-89228).
 

Pathways for AP3B1 Antibody (NBP1-89228)

View related products by pathway.

PTMs for AP3B1 Antibody (NBP1-89228)

Learn more about PTMs related to AP3B1 Antibody (NBP1-89228).

Blogs on AP3B1

There are no specific blogs for AP3B1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP3B1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol AP3B1