AP3B1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: AP3B1 Antibody [NBP1-89228] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: AP3B1 Antibody [NBP1-89228] - Staining of human rectum shows cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AP3B1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VISVSTPAFVPTKTHVLLHRMSGKGLAAHYFFPRQPCIFGDKMVSIQITLNNTTDRKIENIHIGEKKLPIGMKMHVFNPIDSLEPEGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AP3B1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  AP3B1 Protein (NBP1-89228PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AP3B1 Antibody - BSA Free

• Adapter-related protein complex 3 subunit beta-1
• Adaptor protein complex AP-3 subunit beta-1
• adaptor-related protein complex 3, beta 1 subunit
• ADTB3
• ADTB3APE
• AP-3 complex subunit beta-1
• beta-3A-adaptin
• beta3A-adaptin
• Clathrin assembly protein complex 3 beta-1 large chain
• HPS
• HPS2AP-3 complex beta-3A subunit

Background

AP3B1 encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. The encoded protein is part of the heterotetrameric AP-3 protein complex which interacts with the scaffolding protein clathrin. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 2. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP3B1