AP3B1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AP3B1 Antibody [NBP1-89228] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: AP3B1 Antibody [NBP1-89228] - Staining of human rectum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AP3B1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VISVSTPAFVPTKTHVLLHRMSGKGLAAHYFFPRQPCIFGDKMVSIQITLNNTTDRKIENIHIGEKKLPIGMKMHVFNPIDSLEPEGS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AP3B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AP3B1 Protein (NBP1-89228PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AP3B1 Antibody

  • Adapter-related protein complex 3 subunit beta-1
  • Adaptor protein complex AP-3 subunit beta-1
  • adaptor-related protein complex 3, beta 1 subunit
  • ADTB3
  • ADTB3APE
  • AP-3 complex subunit beta-1
  • beta-3A-adaptin
  • beta3A-adaptin
  • Clathrin assembly protein complex 3 beta-1 large chain
  • HPS
  • HPS2AP-3 complex beta-3A subunit

Background

AP3B1 encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. The encoded protein is part of the heterotetrameric AP-3 protein complex which interacts with the scaffolding protein clathrin. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 2. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-23368
Species: Hu
Applications: PAGE
210-TA
Species: Hu
Applications: BA
MAB5018
Species: Hu
Applications: IP, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
D6050
Species: Hu
Applications: ELISA
H00151056-B01P
Species: Hu, Mu
Applications: WB
NBP2-46376
Species: Hu
Applications: IHC, WB
MAB2669
Species: Hu
Applications: IHC, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
NBP2-38958
Species: Hu
Applications: IHC, IHC-P
NBP3-04877
Species: Hu, Mu, Rt
Applications: WB
MAB9167
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB

Publications for AP3B1 Antibody (NBP1-89228) (0)

There are no publications for AP3B1 Antibody (NBP1-89228).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP3B1 Antibody (NBP1-89228) (0)

There are no reviews for AP3B1 Antibody (NBP1-89228). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AP3B1 Antibody (NBP1-89228) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AP3B1 Products

Bioinformatics Tool for AP3B1 Antibody (NBP1-89228)

Discover related pathways, diseases and genes to AP3B1 Antibody (NBP1-89228). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP3B1 Antibody (NBP1-89228)

Discover more about diseases related to AP3B1 Antibody (NBP1-89228).
 

Pathways for AP3B1 Antibody (NBP1-89228)

View related products by pathway.

PTMs for AP3B1 Antibody (NBP1-89228)

Learn more about PTMs related to AP3B1 Antibody (NBP1-89228).

Blogs on AP3B1

There are no specific blogs for AP3B1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP3B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AP3B1