AP2M1 Antibody


Immunohistochemistry: AP2M1 Antibody [NBP1-89055] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

AP2M1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC
Specificity of human AP2M1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AP2M1 Protein (NBP1-89055PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for AP2M1 Antibody

  • Adaptin-mu2
  • adaptor-related protein complex 2, mu 1 subunit
  • AP-2 mu chain
  • Clathrin assembly protein complex 2 medium chain
  • clathrin coat adaptor protein AP50
  • Clathrin coat assembly protein AP50
  • Clathrin coat-associated protein AP50
  • clathrin-associated/assembly/adaptor protein, medium 1
  • HA2 50 kDa subunit
  • KIAA0109
  • mu subunit
  • Plasma membrane adaptor AP-2 50 kDa protein
  • plasma membrane adaptor AP-2 50kDA protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for AP2M1 Antibody (NBP1-89055) (0)

There are no publications for AP2M1 Antibody (NBP1-89055).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP2M1 Antibody (NBP1-89055) (0)

There are no reviews for AP2M1 Antibody (NBP1-89055). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AP2M1 Antibody (NBP1-89055) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional AP2M1 Products

Bioinformatics Tool for AP2M1 Antibody (NBP1-89055)

Discover related pathways, diseases and genes to AP2M1 Antibody (NBP1-89055). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP2M1 Antibody (NBP1-89055)

Discover more about diseases related to AP2M1 Antibody (NBP1-89055).

Pathways for AP2M1 Antibody (NBP1-89055)

View related products by pathway.

Research Areas for AP2M1 Antibody (NBP1-89055)

Find related products by research area.

Blogs on AP2M1

There are no specific blogs for AP2M1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our AP2M1 Antibody and receive a gift card or discount.


Gene Symbol AP2M1