AP2M1 Antibody

Images

 
Immunohistochemistry: AP2M1 Antibody [NBP1-89055] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AP2M1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AP2M1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AP2M1 Protein (NBP1-89055PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AP2M1 Antibody

  • Adaptin-mu2
  • adaptor-related protein complex 2, mu 1 subunit
  • AP-2 mu chain
  • Clathrin assembly protein complex 2 medium chain
  • clathrin coat adaptor protein AP50
  • Clathrin coat assembly protein AP50
  • Clathrin coat-associated protein AP50
  • clathrin-associated/assembly/adaptor protein, medium 1
  • HA2 50 kDa subunit
  • KIAA0109
  • mu subunit
  • Plasma membrane adaptor AP-2 50 kDa protein
  • plasma membrane adaptor AP-2 50kDA protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
21070002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55000
Species: Hu
Applications: ICC/IF
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP1-91674
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-175
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for AP2M1 Antibody (NBP1-89055) (0)

There are no publications for AP2M1 Antibody (NBP1-89055).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP2M1 Antibody (NBP1-89055) (0)

There are no reviews for AP2M1 Antibody (NBP1-89055). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AP2M1 Antibody (NBP1-89055) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AP2M1 Products

Bioinformatics Tool for AP2M1 Antibody (NBP1-89055)

Discover related pathways, diseases and genes to AP2M1 Antibody (NBP1-89055). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP2M1 Antibody (NBP1-89055)

Discover more about diseases related to AP2M1 Antibody (NBP1-89055).
 

Pathways for AP2M1 Antibody (NBP1-89055)

View related products by pathway.

Research Areas for AP2M1 Antibody (NBP1-89055)

Find related products by research area.

Blogs on AP2M1

There are no specific blogs for AP2M1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP2M1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AP2M1