AP2 alpha Antibody (8I8E4)

Western Blot: AP2 alpha Antibody (8I8E4) [NBP3-16108] - Western blot analysis of extracts of various cell lines, using AP2 alpha Rabbit mAb (NBP3-16108) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

• Reactivity: Hu, Mu
• Applications: WB
• Clone: 8I8E4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

AP2 alpha Antibody (8I8E4) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human AP2 alpha (P05549). NADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIH
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TFAP2A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AP2 alpha Antibody (8I8E4)

• Activating enhancer-binding protein 2-alpha
• Activator protein 2
• AP-2 transcription factor
• AP2-alpha
• AP2TFAP-2alpha
• AP-2transcription factor AP-2 alpha (activating enhancer-binding protein 2 alpha)
• BOFS
• FLJ51761
• TFAP2
• transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
• transcription factor AP-2-alpha

Background

AP2-alpha is a 52-kD retinoic acid-inducible and developmentally regulated activator of transcription that binds to a consensus DNA-binding sequence CCCCAGGC in the SV40 and metallothionein (MIM 156350) promoters.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TFAP2A