AP1M2 Antibody - Azide and BSA Free

Western Blot: AP1M2 Antibody [H00010053-B01P] - Analysis of AP1M2 expression in transfected 293T cell line by AP1M2 polyclonal antibody. Lane 1: AP1M2 transfected lysate(46.53 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

AP1M2 Antibody - Azide and BSA Free Summary

• Immunogen: AP1M2 (NP_005489, 1 a.a. - 423 a.a.) full-length human protein. MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLSHGQVHFLWIKHSNLYLVATTSKNANASLVYSFLYKTIEVFCEYFKELEEESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQSNKLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVLFELTGRSKNKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIESVIEKFSHSRVEIMVKAKGQFKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPERNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS
• Specificity: AP1M2 - adaptor-related protein complex 1, mu 2 subunit,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: AP1M2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AP1M2 Antibody - Azide and BSA Free

• Adaptor protein complex AP-1 mu-2 subunit
• Adaptor-related protein complex 1 mu-2 subunit
• adaptor-related protein complex 1, mu 2 subunit
• AP-1 complex subunit mu-2
• AP1-mu2
• AP-mu chain family member mu1B
• Clathrin assembly protein complex 1 medium chain 2
• clathrin coat assembly protein AP47 2
• clathrin coat associated protein AP47 2
• clathrin-associated adaptor medium chain mu2
• golgi adaptor AP-1 47 kDa protein
• Golgi adaptor HA1/AP1 adaptin mu-2 subunit
• HA1 47 kDa subunit 2
• HSMU1B
• MU1B
• MU-1B
• mu1B-adaptin
• mu2
• Mu-adaptin 2

Background

This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP1M2
• Entrez:
  • 10053(Human)
• Uniprot:
  • NP_005489(Human)