Annexin 2 Receptor Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Annexin 2 Receptor Antibody [NBP2-49008] - Staining of human cell line HUVEC TERT2 shows localization to nucleoplasm, cytosol & cytoplasmic bodies.
Immunohistochemistry: Annexin 2 Receptor Antibody [NBP2-49008] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Annexin 2 Receptor Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EYSLDSCDLGLLSSPCWRLPGVYWQNGLSPGVQSTLEPSTAKPTEFSWPGTQKQQEAPVEEVGQAEEPDR
Specificity
Specificity of human Annexin 2 Receptor antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANXA2R
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Annexin 2 Receptor Antibody

  • Annexin II receptor
  • annexin-2 receptor
  • AX2R
  • AXIIR
  • chromosome 5 open reading frame 39

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-57016
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-28635
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, Flow-IC
AF5534
Species: Hu
Applications: WB, Flow, IHC
H00005555-P01
Species: Hu
AF591
Species: Mu
Applications: Flow, IHC, CyTOF-ready
AF2228
Species: Hu
Applications: WB, IHC, ICC
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF640
Species: Mu
Applications: WB, IHC
NBP1-57508
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, IHC, IHC-P
AF226
Species: Hu
Applications: WB
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP2-49008
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Annexin 2 Receptor Antibody (NBP2-49008) (0)

There are no publications for Annexin 2 Receptor Antibody (NBP2-49008).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Annexin 2 Receptor Antibody (NBP2-49008) (0)

There are no reviews for Annexin 2 Receptor Antibody (NBP2-49008). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Annexin 2 Receptor Antibody (NBP2-49008) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Annexin 2 Receptor Products

Bioinformatics Tool for Annexin 2 Receptor Antibody (NBP2-49008)

Discover related pathways, diseases and genes to Annexin 2 Receptor Antibody (NBP2-49008). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Annexin 2 Receptor

There are no specific blogs for Annexin 2 Receptor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Annexin 2 Receptor Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANXA2R