Ankyrin 1 Recombinant Protein Antigen

Images

 
There are currently no images for Ankyrin 1 Protein (NBP2-33806PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Ankyrin 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ANK1.

Source: E. coli

Amino Acid Sequence: FVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ANK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33806.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ankyrin 1 Recombinant Protein Antigen

  • ANK
  • ANK-1
  • ankyrin 1, erythrocytic
  • ankyrin-1
  • ankyrin-R
  • Erythrocyte ankyrin
  • SPH1
  • SPH2

Background

Ankyrins are a family of proteins that link the integral membrane proteins to the underlying spectrin-actincytoskeleton and play key roles in activities such as cell motility, activation, proliferation, contact and themaintenance of specialized membrane domains. Multiple isoforms of ankyrin with different affinities for various targetproteins are expressed in a tissue-specific, developmentally regulated manner. Most ankyrins are typically composed ofthree structural domains: an amino-terminal domain containing multiple ankyrin repeats; a central region with a highlyconserved spectrin binding domain; and a carboxy-terminal regulatory domain which is the least conserved and subjectto variation. Ankyrin 1, the prototype of this family, was first discovered in the erythrocytes, but since has alsobeen found in brain and muscles. Mutations in erythrocytic ankyrin 1 have been associated in approximately half of allpatients with hereditary spherocytosis. Complex patterns of alternative splicing in the regulatory domain, giving riseto different isoforms of ankyrin 1 have been described. Truncated muscle-specific isoforms of ankyrin 1 resulting fromusage of an alternate promoter have also been identified. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27561
Species: Ch, Hu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP3-06185
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-88818
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-49409
Species: Hu
Applications: IHC,  IHC-P
NBP2-33863
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38952
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA
AF6270
Species: Hu
Applications: ICC
NBP1-88071
Species: Hu
Applications: IHC,  IHC-P
NBP2-59310
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF2910
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
MAB5745
Species: Hu
Applications: IHC, WB
NB110-40763
Species: Gp, Hu, Mu, Rt, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-80992
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00002035-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB

Publications for Ankyrin 1 Protein (NBP2-33806PEP) (0)

There are no publications for Ankyrin 1 Protein (NBP2-33806PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ankyrin 1 Protein (NBP2-33806PEP) (0)

There are no reviews for Ankyrin 1 Protein (NBP2-33806PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ankyrin 1 Protein (NBP2-33806PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ankyrin 1 Products

Blogs on Ankyrin 1

There are no specific blogs for Ankyrin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ankyrin 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ANK1