ANKRD33 Antibody

Images

 
Western Blot: ANKRD33 Antibody [NBP2-32400] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry: ANKRD33 Antibody [NBP2-32400] - Staining of human kidney shows strong luminal membranous positivity in cells in tubules.
Western Blot: ANKRD33 Antibody [NBP2-32400] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry: ANKRD33 Antibody [NBP2-32400] - Staining of human kidney shows strong luminal membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKRD33 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ASWGGIVHLEAFGDPVIVLRGAWAVPRVDCLIDTLRTPNASCMRKGTHLLVPCLEEEELALHRRRLDMSEALPCPGKETPTPGCRLGALYWACVHNDPTQL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD33
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ANKRD33 Protein (NBP2-32400PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKRD33 Antibody

  • ankyrin repeat domain 33

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
AF770
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-1834
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-01327
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-27393
Species: Hu, Mu
Applications: WB, Simple Western, IHC-Fr, IHC-P, IP
AF2746
Species: Hu, Mu
Applications: WB, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF1477
Species: Mu
Applications: WB, IHC, Block
NBP2-32400
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ANKRD33 Antibody (NBP2-32400) (0)

There are no publications for ANKRD33 Antibody (NBP2-32400).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD33 Antibody (NBP2-32400) (0)

There are no reviews for ANKRD33 Antibody (NBP2-32400). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANKRD33 Antibody (NBP2-32400) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKRD33 Products

Bioinformatics Tool for ANKRD33 Antibody (NBP2-32400)

Discover related pathways, diseases and genes to ANKRD33 Antibody (NBP2-32400). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD33 Antibody (NBP2-32400)

Discover more about diseases related to ANKRD33 Antibody (NBP2-32400).
 

Pathways for ANKRD33 Antibody (NBP2-32400)

View related products by pathway.

Blogs on ANKRD33

There are no specific blogs for ANKRD33, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD33 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD33