ANKRD2 Antibody


Immunocytochemistry/ Immunofluorescence: ANKRD2 Antibody [NBP1-91669] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: ANKRD2 Antibody [NBP1-91669] - Staining in human skeletal muscle and prostate tissues using anti-ANKRD2 antibody. Corresponding ANKRD2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ANKRD2 Antibody [NBP1-91669] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: ANKRD2 Antibody [NBP1-91669] - Staining of human prostate shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ANKRD2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRD
Specificity of human ANKRD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ANKRD2 Protein (NBP1-91669PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ANKRD2 Antibody

  • ankyrin repeat domain 2 (stretch responsive muscle)
  • ankyrin repeat domain-containing protein 2
  • ankyrin-repeat protein
  • ARPPSkeletal muscle ankyrin repeat protein
  • hArpp
  • MGC104314


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P, IP, PEP-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ICC/IF, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for ANKRD2 Antibody (NBP1-91669) (0)

There are no publications for ANKRD2 Antibody (NBP1-91669).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD2 Antibody (NBP1-91669) (0)

There are no reviews for ANKRD2 Antibody (NBP1-91669). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ANKRD2 Antibody (NBP1-91669) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ANKRD2 Antibody (NBP1-91669)

Discover related pathways, diseases and genes to ANKRD2 Antibody (NBP1-91669). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD2 Antibody (NBP1-91669)

Discover more about diseases related to ANKRD2 Antibody (NBP1-91669).

Pathways for ANKRD2 Antibody (NBP1-91669)

View related products by pathway.

PTMs for ANKRD2 Antibody (NBP1-91669)

Learn more about PTMs related to ANKRD2 Antibody (NBP1-91669).

Blogs on ANKRD2

There are no specific blogs for ANKRD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ANKRD2 Antibody and receive a gift card or discount.


Gene Symbol ANKRD2