ANKLE2 Antibody - Azide and BSA Free

Western Blot: ANKLE2 Antibody [NBP2-92368] - Analysis of extracts of various cell lines, using ANKLE2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

Product Discontinued

ANKLE2 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human ANKLE2 (NP_055929.1). CRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSHHLIVKNSRNKYDKTPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANKLE2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS with 50% glycerol, pH7.3.
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ANKLE2 Antibody - Azide and BSA Free

• ankyrin repeat and LEM domain containing 2
• ankyrin repeat and LEM domain-containing protein 2
• FLJ22280
• FLJ36132
• KIAA0692
• LEM domain containing 7
• LEMD7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANKLE2