Anillin Recombinant Protein Antigen

Images

 
There are currently no images for Anillin Recombinant Protein Antigen (NBP2-33857PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Anillin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Anillin.

Source: E. coli

Amino Acid Sequence: IVKSTLSQTVPSKGELSREICLQSQSKDKSTTPGGTGIKPFLERFGERCQEHSKESPARSTPHRTPIITPNTKAIQERLFKQDTSSSTTHLAQQLKQERQKELACLRGRFDKGNIWSAEKGGNSKSKQLETKQETH

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ANLN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-33857.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Anillin Recombinant Protein Antigen

  • actin-binding protein anillin
  • anillin (Drosophila Scraps homolog), actin binding protein
  • ANILLIN
  • anillin, actin binding protein (scraps homolog, Drosophila)
  • anillin, actin binding protein
  • DKFZp779A055
  • Drosophila Scraps homolog
  • scra
  • Scraps

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1107
Species: Mu
Applications: WB, IHC
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00347527-B01P
Species: Hu
Applications: WB, ELISA
MAB38461
Species: Hu
Applications: WB, IHC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-89158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-33857PEP
Species: Hu
Applications: AC

Publications for Anillin Recombinant Protein Antigen (NBP2-33857PEP) (0)

There are no publications for Anillin Recombinant Protein Antigen (NBP2-33857PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Anillin Recombinant Protein Antigen (NBP2-33857PEP) (0)

There are no reviews for Anillin Recombinant Protein Antigen (NBP2-33857PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Anillin Recombinant Protein Antigen (NBP2-33857PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Anillin Products

Bioinformatics Tool for Anillin Recombinant Protein Antigen (NBP2-33857PEP)

Discover related pathways, diseases and genes to Anillin Recombinant Protein Antigen (NBP2-33857PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Anillin Recombinant Protein Antigen (NBP2-33857PEP)

Discover more about diseases related to Anillin Recombinant Protein Antigen (NBP2-33857PEP).
 

Pathways for Anillin Recombinant Protein Antigen (NBP2-33857PEP)

View related products by pathway.

PTMs for Anillin Recombinant Protein Antigen (NBP2-33857PEP)

Learn more about PTMs related to Anillin Recombinant Protein Antigen (NBP2-33857PEP).

Blogs on Anillin

There are no specific blogs for Anillin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Anillin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ANLN