Angiopoietin-like Protein 5/ANGPTL5 Antibody

Images

 
Western Blot: ANGPTL5 Antibody [NBP1-85870] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: ANGPTL5 Antibody [NBP1-85870] - Staining of human cell line U-2 OS shows positivity in nucleoli, plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: ANGPTL5 Antibody [NBP1-85870] - Staining of human kidney shows strong membrane and cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Angiopoietin-like Protein 5/ANGPTL5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HHSTDSSVVNIVEDGSNAKDESKSNDTVCKEDCEESCDVKTKITREEKHFMCRNLQNSIVSYTRSTKKLLRNMMDEQQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANGPTL5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Angiopoietin-like Protein 5/ANGPTL5 Protein (NBP1-85870PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Angiopoietin-like Protein 5/ANGPTL5 Antibody

  • Angiopoietin like Protein 5
  • angiopoietin-like 5
  • Angiopoietin-like Protein 5
  • angiopoietin-related protein 5
  • ANGPTL5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2204
Species: Hu
Applications: WB, IHC
232-FA/CF
Species: Hu
AF674
Species: Hu
Applications: WB, Simple Western, Neut
NBP2-15394
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1444
Species: Mu
Applications: WB, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-57016
Species: Hu
Applications: WB
AF313
Species: Hu
Applications: WB, Simple Western, IHC, Block
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF964
Species: Hu
Applications: WB, IHC, Block
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
MAB4960
Species: Mu
Applications: WB, IHC
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NBP1-85870
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870) (0)

There are no publications for Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870) (0)

There are no reviews for Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Angiopoietin-like Protein 5/ANGPTL5 Products

Bioinformatics Tool for Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870)

Discover related pathways, diseases and genes to Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870)

Discover more about diseases related to Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870).
 

Pathways for Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870)

View related products by pathway.

PTMs for Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870)

Learn more about PTMs related to Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870).

Blogs on Angiopoietin-like Protein 5/ANGPTL5

There are no specific blogs for Angiopoietin-like Protein 5/ANGPTL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Angiopoietin-like Protein 5/ANGPTL5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANGPTL5
Entrez
Uniprot