Angiopoietin-like Protein 5/ANGPTL5 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: HHSTDSSVVNIVEDGSNAKDESKSNDTVCKEDCEESCDVKTKITREEKHFMCRNLQNSIVSYTRSTKKLLRNMMDEQQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ANGPTL5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Angiopoietin-like Protein 5/ANGPTL5 Antibody - BSA Free
Background
ANGPTL5( AAH49170, 1 a.a. - 389 a.a.) full-length recombinant protein with GST.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, Neut, Simple Western, WB
Species: Hu
Applications: Neut, Simple Western, WB
Species: Mu
Applications: ICC, WB
Species: Hu
Applications: BA
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: Block, IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: Block, IHC, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Publications for Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870) (0)
There are no publications for Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870) (0)
There are no reviews for Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Angiopoietin-like Protein 5/ANGPTL5 Antibody (NBP1-85870) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Angiopoietin-like Protein 5/ANGPTL5 Products
Blogs on Angiopoietin-like Protein 5/ANGPTL5