AMPD1 Antibody - BSA Free

Western Blot: AMPD1 Antibody [NBP1-81269] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Skeletal muscle tissue

Immunohistochemistry-Paraffin: AMPD1 Antibody [NBP1-81269] - Staining of human heart muscle shows low expression as expected.

Immunohistochemistry-Paraffin: AMPD1 Antibody [NBP1-81269] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: AMPD1 Antibody [NBP1-81269] - Staining in human skeletal muscle and heart muscle tissues using anti-AMPD1 antibody. Corresponding AMPD1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AMPD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AMPD1 Antibody - BSA Free (NBP1-81269) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AEEKQIDDAMRNFAEKVFASEVKDEGGRQEISPFDVDEICPISHHEMQAHIFHLETLSTSTEARRKKRFQGRKTVNLSIPL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AMPD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  AMPD1 Protein (NBP1-81269PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AMPD1 Antibody - BSA Free

• adenosine monophosphate deaminase 1 (isoform M)
• adenosine monophosphate deaminase 1
• adenosine monophosphate deaminase-1 (muscle)
• AMP deaminase 1
• AMP deaminase isoform M
• AMPD
• EC 3.5.4.6
• MAD
• MADA
• Myoadenylate deaminase
• skeletal muscle AMPD

Background

Adenosine monophosphate deaminase 1 catalyzes the deamination of AMP to IMP in skeletal muscle and plays an important role in the purine nucleotide cycle. Two other genes have been identified, AMPD2 and AMPD3, for the liver- and erythocyte-specific isoforms, respectively. Deficiency of the muscle-specific enzyme is apparently a common cause of exercise-induced myopathy and probably the most common cause of metabolic myopathy in the human.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AMPD1