We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Aminopeptidase PILS/ARTS1 Recombinant Protein Antigen

Images

 
There are currently no images for Aminopeptidase PILS/ARTS1 Recombinant Protein Antigen (NBP2-59005PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Aminopeptidase PILS/ARTS1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to Aminopeptidase PILS/ARTS1.

Source: E. coli

Amino Acid Sequence: FQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ERAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-59005.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Aminopeptidase PILS/ARTS1 Recombinant Protein Antigen

  • Adipocyte-derived leucine aminopeptidase
  • A-LAP
  • A-LAPALAP
  • Aminopeptidase PILS
  • ARTS1
  • ARTS1aminopeptidase regulator of TNFR1 shedding
  • ARTS-1PILSAP
  • EC 3.4.11
  • EC 3.4.11.-
  • EC 3.4.11.1
  • endoplasmic reticulum aminopeptidase 1
  • endoplasmic reticulum aminopeptidase associated with antigen processing
  • ERAAP1
  • ERAP1
  • KIAA0525APPILS
  • PILS-AP
  • PILS-APERAAP
  • Puromycin-insensitive leucyl-specific aminopeptidase
  • Type 1 tumor necrosis factor receptor shedding aminopeptidase regulator

Background

The endoplasmic reticulum (ER) aminopeptidase 1 (ERAP1) is a 120 kDa protein localized to the lumen of the ER, which removes NH2-terminal residues from many antigenic precursors for MHC class I peptide presentation. Peptides that are presented by MHC class I on the surface of a cell must be 8-11 residues long, and ERAP1 specifically trims peptides of 9 amino acids or more. ERAP1 is also induced by interferon-gamma. The gene encoding human ERAP1 maps to chromosome 5q15. ERAP1 has previously been characterized as adipocyte-derived leucine aminopeptidase (A-LAP), puromycin-insensitive leucine-specific aminopeptidase (PILS-AP) and aminopeptidase regulator of TNFR1 shedding (ARTS-1). A-LAP is thought to inactivate several bioactive peptides, including angiotensin II and, subsequently, may be involved in the regulation of blood pressure. PILS-AP is described as playing a role in angiogenesis by regulating the proliferation and migration of endothelial cells, and ARTS-1 is characterized as a TNFR1 binding protein that promotes TNFR1 shedding. Further research will be necessary to fully elucidate the functions of this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6386
Species: Hu
Applications: IP, WB
NBP1-82847
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3830
Species: Hu
Applications: IP, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP2-27091
Species: Hu, Pm
Applications: IHC,  IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00006890-M04
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-80573
Species: Mu
Applications: CyTOF-ready, Flow, IHC,  IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-64775
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, Func, IHC, IHC-Fr, IHC-P (-), IP
H00005696-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-87466
Species: Hu
Applications: IHC,  IHC-P
NBP2-79709
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP2-31769
Species: Hu
Applications: IHC,  IHC-P
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
7268-CT
Species: Hu
Applications: BA

Publications for Aminopeptidase PILS/ARTS1 Recombinant Protein Antigen (NBP2-59005PEP) (0)

There are no publications for Aminopeptidase PILS/ARTS1 Recombinant Protein Antigen (NBP2-59005PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aminopeptidase PILS/ARTS1 Recombinant Protein Antigen (NBP2-59005PEP) (0)

There are no reviews for Aminopeptidase PILS/ARTS1 Recombinant Protein Antigen (NBP2-59005PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Aminopeptidase PILS/ARTS1 Recombinant Protein Antigen (NBP2-59005PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aminopeptidase PILS/ARTS1 Products

Research Areas for Aminopeptidase PILS/ARTS1 Recombinant Protein Antigen (NBP2-59005PEP)

Find related products by research area.

Blogs on Aminopeptidase PILS/ARTS1

There are no specific blogs for Aminopeptidase PILS/ARTS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Aminopeptidase PILS/ARTS1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ERAP1