Recombinant Human Aminopeptidase B/RNPEP Protein

Images

 
SDS-Page: Recombinant Human Aminopeptidase B/RNPEP Protein [H00006051-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Aminopeptidase B/RNPEP Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 551-650 of Human RNPEP partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GNVKKLGDTYPSISNARNAELRLRWGQIVLKNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPKGS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RNPEP

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Aminopeptidase B/RNPEP Protein

  • Aminopeptidase B
  • APB
  • AP-B
  • Arginine aminopeptidase
  • arginyl aminopeptidase (aminopeptidase B)
  • Arginyl Aminopeptidase
  • DKFZp547H084
  • EC 3.4.11
  • EC 3.4.11.6
  • RNPEP

Background

RNPEP - arginyl aminopeptidase (aminopeptidase B)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-1885
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6386
Species: Hu
Applications: WB, IP
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12154
Species: Hu
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
H00006051-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Aminopeptidase B/RNPEP Partial Recombinant Protein (H00006051-Q01) (0)

There are no publications for Aminopeptidase B/RNPEP Partial Recombinant Protein (H00006051-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aminopeptidase B/RNPEP Partial Recombinant Protein (H00006051-Q01) (0)

There are no reviews for Aminopeptidase B/RNPEP Partial Recombinant Protein (H00006051-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aminopeptidase B/RNPEP Partial Recombinant Protein (H00006051-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aminopeptidase B/RNPEP Products

Bioinformatics Tool for Aminopeptidase B/RNPEP Partial Recombinant Protein (H00006051-Q01)

Discover related pathways, diseases and genes to Aminopeptidase B/RNPEP Partial Recombinant Protein (H00006051-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aminopeptidase B/RNPEP Partial Recombinant Protein (H00006051-Q01)

Discover more about diseases related to Aminopeptidase B/RNPEP Partial Recombinant Protein (H00006051-Q01).

Blogs on Aminopeptidase B/RNPEP

There are no specific blogs for Aminopeptidase B/RNPEP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Aminopeptidase B/RNPEP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNPEP
Entrez