Home » AMELX » AMELX Research Products » AMELX Antibody

AMELX Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: AMELX Antibody [H00000265-D01P] - Analysis of AMELX expression in transfected 293T cell line by AMELX polyclonal antibody.Lane 1: AMELX transfected lysate(21.60 KDa).Lane 2: Non-transfected lysate.
Western Blot: AMELX Antibody [H00000265-D01P] - Analysis of AMELX expression in transfected 293T cell line by AMELX polyclonal antibody.Lane 1: AMELX transfected lysate(21.60 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, PlSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

AMELX Antibody Summary

Immunogen
AMELX (NP_001133.1, 1 a.a. - 191 a.a.) full-length human protein. MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
Specificity
AMELX - amelogenin (amelogenesis imperfecta 1, X-linked),
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMELX
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00000265-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AMELX Antibody

  • AIH1
  • ALGN
  • amelogenin (amelogenesis imperfecta 1, X-linked)
  • amelogenin (X chromosome, amelogenesis imperfecta 1)
  • amelogenin, X isoform
  • amelogenin, X-linked
  • AMGAMGL
  • AMGXamelogenesis imperfecta 1

Background

This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in this gene cause X-linked amelogenesis imperfecta. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
Enamelin GST (N-Term) ...
H00010117-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
(1 Publication)
Species: Hu
Ameloblastin
Antibody
AF3026
Ameloblastin Antibody
(1 Publication)
Species: Mu
Applications: WB
MMP-25/MT6-MMP
Antibody (141808) [Un ...
MAB1142
MMP-25/MT6-MMP Antibody (141808) [Unconjugated]
(2 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready
MMP20 Antibody
NBP1-62322
Western Blot: MMP20 Antibody [NBP1-62322] - HepG2 tissue lysate at a concentration of 1ug/ml.
Western Blot: MMP20 Antibody [NBP1-62322] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Species: Hu
Applications: WB
Tuftelin 1 Antibody
NBP1-87446
Western Blot: Tuftelin 1 Antibody [NBP1-87446] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Tuftelin 1 Antibody [NBP1-87446] - Staining of human tonsil shows weak cytoplasmic positivity in squamous epithelial cells.
Western Blot: Tuftelin 1 Antibody [NBP1-87446] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-614
(1 Publication)
Species: Hu, Rt
Applications: WB, IHC, IHC-P
DSPP Antibody
NBP2-92546
Western Blot: DSPP Antibody [NBP2-92546] - Analysis of extracts of various cell lines, using DSPP at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.
Immunocytochemistry/Immunofluorescence: DSPP Antibody [NBP2-92546] - Analysis of U-2 OS cells using DSPP. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: DSPP Antibody [NBP2-92546] - Analysis of H9C2 cells using DSPP. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AMGL Antibody
NBP1-98264
Western Blot: AMGL Antibody [NBP1-98264] - Antibody Dilution: 1.0ug/ml Sample Tissue: Human Thymus.
Species: Hu
Applications: WB
iNOS Antibody
NB300-605
Western Blot: iNOS Antibody [NB300-605] - Analysis of iNOS was performed by loading 20 ug of RAW264 whole cell lysate untreated (left lane) or stimulated with LPS at 1 ug/mL for 16 hours (right lane) and 10 uL of PageRuler Plus Prestained Protein Ladder onto a 4-20% Tris-Glycine polyacrylamide gel. Proteins were transferred to a nitrocellulose membrane and blocked with 5% Milk in TBST for at least 1 hour. The membrane was probed with an iNOS Rabbit polyclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBST, and probed with a Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP conjugate at a dilution of 1:1000 for 1 hour. Chemiluminescent detection was performed using SuperSignal West Pico.
Immunohistochemistry-Paraffin: iNOS Antibody [NB300-605] - Immunohistochemistry was performed on normal deparaffinized human Lung tissue.
Immunohistochemistry-Paraffin: iNOS Antibody [NB300-605] - Immunohistochemistry was performed on normal deparaffinized human Heart tissue.
(3 Reviews)
(56 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
Human PTH ELISA
Kit (Colorimetric)
NBP2-60629
ELISA: Human PTH ELISA Kit (Colorimetric) [NBP2-60629]
(1 Publication)
Species: Hu
SGLT1/SLC5A1
Antibody
NBP2-20338
Western Blot: SGLT1/SLC5A1 Antibody [NBP2-20338] - Sample (30 ug of whole cell lysate) A: Raji 7.5% SDS PAGE SGLT1 antibody diluted at 1:1000
Immunocytochemistry/Immunofluorescence: SGLT1/SLC5A1 Antibody [NBP2-20338] - Analysis of methanol-fixed A431, using SGLT1antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: SGLT1/SLC5A1 Antibody [NBP2-20338] - Analysis of paraffin-embedded lung fibrose tissue at 1:100 dilution.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
C-Reactive
Protein/CRP [HRP]
DCRP00
(3 Reviews)
(83 Publications)
Species: Hu
IBSP/Sialoprotein
II
4014-SP
IBSP/Sialoprotein II
(2 Publications)
Species: Hu
Osteopontin/OPN
Antibody [Unconjugate
AF808
Osteopontin/OPN was detected in immersion fixed C2C12 mouse myoblast cell line (left panel, positive stain) and mouse splenocytes (right panel, negative stain) using Goat Anti-Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and secreted molecule. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Recombinant Mouse Osteopontin/OPN (Catalog # 441-OP), immobilized onto a microplate, supports the adhesion of the HEK293 human embryonic kidney cell line in a dose-dependent manner (orange line). Adhesion elicited by Recombinant Mouse Osteopontin/OPN (2 µg/mL) is neutralized (green line) by increasing concentrations of Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808). The ND50 is typically 1‑3 µg/mL.
Osteopontin/OPN was detected in perfusion fixed frozen sections of mouse thymus using Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(7 Reviews)
(81 Publications)
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
Kallikrein
4/Prostase/EMSP1 Anti ...
MAB35661
Kallikrein 4/Prostase/EMSP1 was detected in immersion fixed paraffin-embedded sections of human prostate using Mouse Anti-Human Kallikrein 4/Prostase/EMSP1 Monoclonal Antibody (Catalog # MAB35661) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC, IP, Neut
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
(38 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Calcium-sensing
R/CaSR Antibody (5C10 ...
NB120-19347
Western Blot: Calcium-sensing R/CaSR Antibody (5C10, ADD) [NB120-19347] - Total protein from human Hek293 and rat Pancreas was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-CaSR in block buffer and detected with an anti-mouse HRP secondary antibody using West Pico PLUS chemiluminescence detection reagent.
Immunocytochemistry/Immunofluorescence: Calcium-sensing R/CaSR Antibody (5C10, ADD) [NB120-19347] - Analysis of bovine corneal epithelium (CE) limbus tissue.
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody (5C10, ADD) [NB120-19347] - Normal biopsies of deparaffinized Human kidney tissue.
(20 Publications)
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Aminopeptidase
LRAP/ERAP2 Antibody ( ...
MAB3830
Aminopeptidase LRAP/ERAP2 Antibody (3F5)
(1 Review)
(4 Publications)
Species: Hu
Applications: WB
SLC30A3 Antibody
NBP2-31825
Immunohistochemistry-Paraffin: SLC30A3 Antibody [NBP2-31825] - Staining of human stomach shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: SLC30A3 Antibody [NBP2-31825] - Analysis in human epididymis and stomach tissues. Corresponding SLC30A3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC30A3 Antibody [NBP2-31825] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu
Applications: IHC, IHC-P

Publications for AMELX Antibody (H00000265-D01P)(1)


Reviews for AMELX Antibody (H00000265-D01P) (0)

There are no reviews for AMELX Antibody (H00000265-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMELX Antibody (H00000265-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional AMELX Products

Bioinformatics Tool for AMELX Antibody (H00000265-D01P)

Discover related pathways, diseases and genes to AMELX Antibody (H00000265-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMELX Antibody (H00000265-D01P)

Discover more about diseases related to AMELX Antibody (H00000265-D01P).
 

Pathways for AMELX Antibody (H00000265-D01P)

View related products by pathway.

PTMs for AMELX Antibody (H00000265-D01P)

Learn more about PTMs related to AMELX Antibody (H00000265-D01P).

Blogs on AMELX

There are no specific blogs for AMELX, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMELX Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol AMELX
Entrez
Uniprot