AMGL Antibody

Images

 
Western Blot: AMGL Antibody [NBP1-98264] - Antibody Dilution: 1.0ug/ml Sample Tissue: Human Thymus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AMGL Antibody Summary

Immunogen
The immunogen for this antibody is AMGL C-terminal region (NP_001134). Peptide Sequence: QPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMELY
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AMGL Antibody

  • amelogenin, Y isoform
  • amelogenin, Y-linked
  • AMGL
  • AMGY

Background

This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in a related gene on chromosome X cause X-linked amelogenesis imperfecta.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22683
Species: Hu
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
H00007258-Q01
Species: Hu
H00001617-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-57923
Species: Hu
Applications: ICC/IF
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-32887
Species: Hu
Applications: WB, IHC, IHC-P
H00000395-M01
Species: Hu
Applications: WB, ELISA
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-32780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-79749
Species: Hu
Applications: WB
22240002
Species: Hu
Applications: WB, ELISA
NBP1-84971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80582
Species: Hu
Applications: IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO

Publications for AMGL Antibody (NBP1-98264) (0)

There are no publications for AMGL Antibody (NBP1-98264).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMGL Antibody (NBP1-98264) (0)

There are no reviews for AMGL Antibody (NBP1-98264). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMGL Antibody (NBP1-98264) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP1-98264

Bioinformatics Tool for AMGL Antibody (NBP1-98264)

Discover related pathways, diseases and genes to AMGL Antibody (NBP1-98264). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMGL Antibody (NBP1-98264)

Discover more about diseases related to AMGL Antibody (NBP1-98264).
 

Pathways for AMGL Antibody (NBP1-98264)

View related products by pathway.

PTMs for AMGL Antibody (NBP1-98264)

Learn more about PTMs related to AMGL Antibody (NBP1-98264).

Blogs on AMGL

There are no specific blogs for AMGL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMGL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMELY
Entrez
Uniprot