AMBRA1 Antibody

Immunocytochemistry/Immunofluorescence: AMBRA1 Antibody [NBP2-32640] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria & vesicles.

Immunohistochemistry-Paraffin: AMBRA1 Antibody [NBP2-32640] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Discontinued

AMBRA1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WCVTFHPTISGLIASGCLDGEVRIWDLHGGSESWFTDSNNAIASLAFHPTAQLLLIATANEIHFWDWSRREPFAVVKTASEMERVRL
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AMBRA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AMBRA1 Antibody

• activating molecule in BECN1-regulated autophagy protein 1
• autophagy/beclin-1 regulator 1
• DCAF3
• DDB1 and CUL4 associated factor 3
• FLJ20294
• KIAA1736activating molecule in beclin-1-regulated autophagy
• MGC33725
• WD repeat domain 94
• WDR94

Background

AMBRA1 regulates autophagy and development of the nervous system. It is a large, previously unknown protein bearing a WD40 domain at its amino terminus, regulates autophagy and has a crucial role in embryogenesis. AMBRA1 is a positive regulator of the Becn1-dependent programme of autophagy, as revealed by its overexpression and by RNA interference experiments invitro. Notably, AMBRA1 functional deficiency in mouse embryos leads to severe neural tube defects associated with autophagy impairment, accumulation of ubiquitinated proteins, unbalanced cell proliferation and excessive apoptotic cell death.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AMBRA1