AMBRA1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AMBRA1 Antibody [NBP2-32640] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria & vesicles.
Immunohistochemistry-Paraffin: AMBRA1 Antibody [NBP2-32640] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AMBRA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WCVTFHPTISGLIASGCLDGEVRIWDLHGGSESWFTDSNNAIASLAFHPTAQLLLIATANEIHFWDWSRREPFAVVKTASEMERVRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMBRA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AMBRA1 Protein (NBP2-32640PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AMBRA1 Antibody

  • activating molecule in BECN1-regulated autophagy protein 1
  • autophagy/beclin-1 regulator 1
  • DCAF3
  • DDB1 and CUL4 associated factor 3
  • FLJ20294
  • KIAA1736activating molecule in beclin-1-regulated autophagy
  • MGC33725
  • WD repeat domain 94
  • WDR94

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB110-87320
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF
NBP2-24733
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB6608
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
AF877
Species: Hu
Applications: WB, IHC, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-43644
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-32640
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for AMBRA1 Antibody (NBP2-32640) (0)

There are no publications for AMBRA1 Antibody (NBP2-32640).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMBRA1 Antibody (NBP2-32640) (0)

There are no reviews for AMBRA1 Antibody (NBP2-32640). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AMBRA1 Antibody (NBP2-32640) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AMBRA1 Products

Bioinformatics Tool for AMBRA1 Antibody (NBP2-32640)

Discover related pathways, diseases and genes to AMBRA1 Antibody (NBP2-32640). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMBRA1 Antibody (NBP2-32640)

Discover more about diseases related to AMBRA1 Antibody (NBP2-32640).
 

Pathways for AMBRA1 Antibody (NBP2-32640)

View related products by pathway.

PTMs for AMBRA1 Antibody (NBP2-32640)

Learn more about PTMs related to AMBRA1 Antibody (NBP2-32640).
 

Research Areas for AMBRA1 Antibody (NBP2-32640)

Find related products by research area.

Blogs on AMBRA1.

Beclin 2, a mammal-specific homolog of Beclin 1 with unique functional similarities and differences
Beclin 2 (BECN2) is also called Beclin-1-like protein 1/ BECN1P1 and it was recently identified by He et al 2013 as a mammal-specific homolog of the evolutionarily conserved protein Beclin 1 which is well established for its role in the regulation...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMBRA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMBRA1