ALX3 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ALX3. Peptide sequence: SAAHPGIYSIHGFPPTLGGHSFEPSSDGDYKSPSLVSLRVKPKEPPGLLN The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ALX3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ALX3 Antibody - BSA Free
Background
Aristaless-related genes are a group of paired-related homeobox genes which play a role in regulating vertebrate embryogenesis. The homeodomain transciption factor aristaless-like 3 (ALX3) is expressed in mouse embryos from 8 days of gestation, predominantly in neural crest-derived mesenchyme and in lateral plate mesoderm. Expression analysis of human and mouse tissue reveals predominant ALX3 expression in brain tissue. The Alx3 gene maps to chromosome 1p23-p13 and encodes a 343 amino acid protein. Preferential methylation of Alx3 occurs in advanced-stage neuroblastoma and may repress ALX3 expression. Treatment with the methylation inhibitor 5-aza-2'-deoxycytidine restores ALX3 expression. Alx3 (-) mice lack a phenotype distinct from wild-type mice, however Alx3/Alx4 double mutants demonstrate severe craniofacial abnormalities not present in Alx4 single mutants. Specifically, Alx3/Alx4 double mutant newborn mice have cleft nasal regions in addition to malformation of other neural crest-derived skull structures.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Rt
Applications: DB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt, Ze
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ICC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: WB
Publications for ALX3 Antibody (NBP2-83932) (0)
There are no publications for ALX3 Antibody (NBP2-83932).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ALX3 Antibody (NBP2-83932) (0)
There are no reviews for ALX3 Antibody (NBP2-83932).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ALX3 Antibody (NBP2-83932) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ALX3 Products
Blogs on ALX3