AlphaB Crystallin/CRYAB Antibody (6C9R1)

Western Blot: AlphaB Crystallin/CRYAB Antibody (6C9R1) [NBP3-16844] - Western blot analysis of extracts of various cell lines, using AlphaB Crystallin/CRYAB Rabbit mAb (NBP3-16844) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunocytochemistry/Immunofluorescence: AlphaB Crystallin/CRYAB Antibody (6C9R1) [NBP3-16844] - Immunofluorescence analysis of C6 cells using AlphaB Crystallin/CRYAB Rabbit mAb (NBP3-16844) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: AlphaB Crystallin/CRYAB Antibody (6C9R1) [NBP3-16844] - Immunohistochemistry of paraffin-embedded rat kidney using AlphaB Crystallin/CRYAB Rabbit mAb (NBP3-16844) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

• Reactivity: Rt
• Applications: WB, ICC/IF, IHC
• Clone: 6C9R1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

AlphaB Crystallin/CRYAB Antibody (6C9R1) Summary

• Description: Novus Biologicals Rabbit AlphaB Crystallin/CRYAB Antibody (6C9R1) (NBP3-16844) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 76-175 of human AlphaB Crystallin/CRYAB (P02511). SVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CRYAB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AlphaB Crystallin/CRYAB Antibody (6C9R1)

• alpha B crystallin
• alpha(B)-crystallin
• AlphaB Crystallin
• alpha-crystallin B chain
• CRYA2
• CRYA2alpha crystallin B chain
• CRYAB
• crystallin, alpha B
• CTPP2
• Heat shock protein beta-5
• heat-shock 20 kD like-protein
• HSPB5
• Renal carcinoma antigen NY-REN-27
• Rosenthal fiber component

Background

Crystallin AB is a member of the small heat shock protein family and expressed in several tissues including brain, kidney cardiac and skeletal muscle. Crystallin AB functions as a molecular chaperone and in intracellular architecture. Crystallin AB has shown to have interactions with CRYAA, CRYGC, CRYBB2, CRYBA1 and HSPB8. Defects in crystalline AB have been linked to cause myopathy myofibrillar type 2, cataract posterior polar type 2, and myopathy myofibrillar fatal infantile hypertonic alpha-B crystallin-related (MFMFIH-CRYAB).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CRYAB