alpha-Synuclein Antibody

Images

 
Western Blot: Synuclein-alpha Antibody [H00006622-D01P] - Analysis of SNCA expression in transfected 293T cell line by SNCA polyclonal antibody.Lane 1: SNCA transfected lysate(14.50 KDa).Lane 2: Non-transfected lysate.
Proximity Ligation Assay: Synuclein-alpha Antibody [H00006622-D01P] - Analysis of protein-protein interactions between SNCA and APP. HeLa cells were stained with anti-SNCA rabbit purified polyclonal 1:1200 and anti-APP ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

alpha-Synuclein Antibody Summary

Immunogen
SNCA (NP_000336.1, 1 a.a. - 140 a.a.) full-length human protein. MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Specificity
SNCA,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNCA
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Proximity Ligation Assay
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for alpha-Synuclein Antibody

  • alpha-Synuclein
  • Lewy body) 4
  • MGC110988
  • NACP
  • non A-beta component of AD amyloid
  • Non-A beta component of AD amyloid
  • Non-A4 component of amyloid precursor
  • non-A4 component of amyloid
  • PARK1
  • PARK4
  • PD1
  • SNCA
  • synuclein, alpha (non A4 component of amyloid precursor)
  • Synuclein-alpha

Background

Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Four alternatively spliced transcripts encoding two different isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5528
Species: Hu
Applications: WB, IHC
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-55955
Species: Hu
Applications: ICC/IF, IHC-P
BC100-494
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-54899
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
H00005071-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA

Publications for alpha-Synuclein Antibody (H00006622-D01P) (0)

There are no publications for alpha-Synuclein Antibody (H00006622-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha-Synuclein Antibody (H00006622-D01P) (0)

There are no reviews for alpha-Synuclein Antibody (H00006622-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha-Synuclein Antibody (H00006622-D01P). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for an alpha-Synuclein antibody with an epitope located in the first half (N-terminus) of the protein - preferably a monoclonal antibody. Can you help me with that?
    • Please take a look at NB110-57475. It has been validated for human, rat and mouse and the applications ICC and WB and the epitope it detects is in the N terminal.

Secondary Antibodies

 

Isotype Controls

Additional alpha-Synuclein Products

Bioinformatics Tool for alpha-Synuclein Antibody (H00006622-D01P)

Discover related pathways, diseases and genes to alpha-Synuclein Antibody (H00006622-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha-Synuclein Antibody (H00006622-D01P)

Discover more about diseases related to alpha-Synuclein Antibody (H00006622-D01P).
 

Pathways for alpha-Synuclein Antibody (H00006622-D01P)

View related products by pathway.

PTMs for alpha-Synuclein Antibody (H00006622-D01P)

Learn more about PTMs related to alpha-Synuclein Antibody (H00006622-D01P).
 

Research Areas for alpha-Synuclein Antibody (H00006622-D01P)

Find related products by research area.

Blogs on alpha-Synuclein.

The role of Parkin and autophagy in retinal pigment epithelial cell (RPE) degradation
The root of Parkinson’s disease (PD) points to a poorly regulated electron transport chain leading to mitochondrial damage, where many proteins need to work cohesively to ensure proper function.  The two key players of this pathway are PINK1,...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha-Synuclein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNCA
Entrez
Uniprot