Recombinant Human Alpha-mannosidase II Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Alpha-mannosidase II Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1045 - 1144 of Human MAN2A1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFRIQLR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MAN2A1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Alpha-mannosidase II Protein

  • alpha-mannosidase 2
  • AMan II
  • EC 3.2.1
  • EC 3.2.1.114
  • Golgi alpha-mannosidase II
  • golgi integral membrane protein 7
  • GOLIM7
  • Man II
  • MANA2MANII
  • Mannosidase alpha class 2A member 1
  • mannosidase, alpha type II
  • mannosidase, alpha, class 2A, member 1
  • Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase

Background

MAN2A1 - mannosidase, alpha, class 2A, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81326
Species: Hu
Applications: IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83159
Species: Hu
Applications: IHC, IHC-P
640-A3
Species: Mu
NB100-93414
Species: Hu
Applications: WB, PEP-ELISA
NBP2-37322
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45868
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85732
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP1-27946
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
H00004124-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Alpha-mannosidase II Partial Recombinant Protein (H00004124-Q01) (0)

There are no publications for Alpha-mannosidase II Partial Recombinant Protein (H00004124-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alpha-mannosidase II Partial Recombinant Protein (H00004124-Q01) (0)

There are no reviews for Alpha-mannosidase II Partial Recombinant Protein (H00004124-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Alpha-mannosidase II Partial Recombinant Protein (H00004124-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Alpha-mannosidase II Products

Bioinformatics Tool for Alpha-mannosidase II Partial Recombinant Protein (H00004124-Q01)

Discover related pathways, diseases and genes to Alpha-mannosidase II Partial Recombinant Protein (H00004124-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alpha-mannosidase II Partial Recombinant Protein (H00004124-Q01)

Discover more about diseases related to Alpha-mannosidase II Partial Recombinant Protein (H00004124-Q01).
 

Pathways for Alpha-mannosidase II Partial Recombinant Protein (H00004124-Q01)

View related products by pathway.

PTMs for Alpha-mannosidase II Partial Recombinant Protein (H00004124-Q01)

Learn more about PTMs related to Alpha-mannosidase II Partial Recombinant Protein (H00004124-Q01).

Blogs on Alpha-mannosidase II

There are no specific blogs for Alpha-mannosidase II, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF
IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Alpha-mannosidase II Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAN2A1