Alpha Fodrin Antibody (9H5V8)

Western Blot: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] - Analysis of extracts of various cell lines, using Alpha Fodrin Rabbit mAb (NBP3-16131) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] - Analysis of extracts of HeLa cells, using Alpha Fodrin Rabbit mAb (NBP3-16131) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] - Immunohistochemistry analysis of Alpha Fodrin in paraffin-embedded human thyroid cancer tissue using Alpha Fodrin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] - Immunohistochemistry analysis of Alpha Fodrin in paraffin-embedded mouse colon tissue using Alpha Fodrin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] - Immunohistochemistry analysis of Alpha Fodrin in paraffin-embedded human colon carcinoma tissue using Alpha Fodrin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] - Immunohistochemistry analysis of Alpha Fodrin in paraffin-embedded rat colon tissue using Alpha Fodrin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] - Immunohistochemistry analysis of Alpha Fodrin in paraffin-embedded human liver cancer tissue using Alpha Fodrin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] - Immunohistochemistry analysis of Alpha Fodrin in paraffin-embedded rat kidney tissue using Alpha Fodrin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 9H5V8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Alpha Fodrin Antibody (9H5V8) Summary

• Description: Novus Biologicals Rabbit Alpha Fodrin Antibody (9H5V8) (NBP3-16131) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Alpha Fodrin (Q13813). MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIV
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SPTAN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Alpha Fodrin Antibody (9H5V8)

• Alpha-II spectrin
• EIEE5
• FLJ17738
• FLJ44613
• Fodrin alpha chain
• NEAS
• spectrin alpha chain, brain
• spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)
• Spectrin, non-erythroid alpha chain
• SPTA2

Background

SPTAN1/Alpha II-spectrin is one of two polypeptide chains (alpha and beta) that are part of the fodrin tetramer. Fodrin functions to link actin filaments to the plasma membrane and is a major neuronal cytoskeletal protein. Fodrin has been linked to neurogenerative and autoimmune diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPTAN1