Alpha Actinin 2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Alpha Actinin 2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACTN2.
  
  

  Source: E. coli

  Amino Acid Sequence: AHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ACTN2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90376.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Alpha Actinin 2 Recombinant Protein Antigen

• Actinin alpha 2
• actinin, alpha 2
• Actinin-a2
• ACTN2
• alpha Actinin 2
• alpha-Actinin 2
• Alpha-actinin skeletal muscle isoform 2
• Alpha-Actinin Skeletal Muscle
• Alpha-Actinin-2
• CMD1AA
• F-actin cross-linking protein

Background

Alpha actinin 2 is an actin binding proteins that carry out different purposes in different different cell types. Skeletal, cardiac, and smooth muscle isoforms are localized to the Z disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. ACTN2 encodes a muscle-specific, alpha actinin isoform that is expressed in both skeletal and cardiac muscles. There are several known transcript variants that result from the use of multiple polyA+ sites. ACTN2 has the ability to form both homo- and heterodimers (with ACTN3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ACTN2