ALG13 Antibody

Images

 
Western Blot: ALG13 Antibody [NBP1-84330] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: ALG13 Antibody [NBP1-84330] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALG13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALG13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Detects 18 kDa isoform in WB.
Control Peptide
ALG13 Protein (NBP1-84330PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALG13 Antibody

  • asparagine-linked glycosylation 13 homolog (S. cerevisiae)
  • Asparagine-linked glycosylation 13 homolog
  • chromosome X open reading frame 45
  • CXorf45
  • EC 2.4.1.141
  • FLJ23018
  • FLJ31785
  • GLT28D1
  • glycosyltransferase 28 domain containing 1
  • Glycosyltransferase 28 domain-containing protein 1
  • hematopoietic stem/progenitor cells protein MDS031
  • MDS031
  • MGC12423
  • UDP-N-acetylglucosamine transferase subunit ALG13 homolog
  • YGL047W

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30914
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32539
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30375
Species: Hu
Applications: IHC, IHC-P
NBP1-77847
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP
NBP2-03754
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00168400-D01P
Species: Hu
Applications: WB, ELISA
NBP2-56444
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP2-31622
Species: Hu
Applications: IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
AF4779
Species: Hu
Applications: WB, IHC
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-33101
Species: Hu
Applications: WB, ICC/IF
NBP2-14085
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-57260
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84330
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ALG13 Antibody (NBP1-84330) (0)

There are no publications for ALG13 Antibody (NBP1-84330).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG13 Antibody (NBP1-84330) (0)

There are no reviews for ALG13 Antibody (NBP1-84330). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALG13 Antibody (NBP1-84330) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALG13 Products

Bioinformatics Tool for ALG13 Antibody (NBP1-84330)

Discover related pathways, diseases and genes to ALG13 Antibody (NBP1-84330). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALG13 Antibody (NBP1-84330)

Discover more about diseases related to ALG13 Antibody (NBP1-84330).
 

Pathways for ALG13 Antibody (NBP1-84330)

View related products by pathway.

PTMs for ALG13 Antibody (NBP1-84330)

Learn more about PTMs related to ALG13 Antibody (NBP1-84330).

Blogs on ALG13

There are no specific blogs for ALG13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALG13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALG13
Entrez
Uniprot