ALG14 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ALG14 Antibody [NBP2-30914] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry: ALG14 Antibody [NBP2-30914] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALG14 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SLSILVVAGSGGHTTEILRLLGSLSNAYSPRHYVIADTDEMSANKINSFELDRADRDPSNMYTKYYIHRIPRSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALG14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ALG14 Protein (NBP2-30914PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALG14 Antibody

  • asparagine-linked glycosylation 14 homolog (S. cerevisiae)
  • asparagine-linked glycosylation 14 homolog (yeast)
  • MGC19780
  • UDP-N-acetylglucosamine transferase subunit ALG14 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84330
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32539
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85715
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP2-30375
Species: Hu
Applications: IHC, IHC-P
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-30914
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ALG14 Antibody (NBP2-30914) (0)

There are no publications for ALG14 Antibody (NBP2-30914).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG14 Antibody (NBP2-30914) (0)

There are no reviews for ALG14 Antibody (NBP2-30914). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ALG14 Antibody (NBP2-30914) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALG14 Products

Bioinformatics Tool for ALG14 Antibody (NBP2-30914)

Discover related pathways, diseases and genes to ALG14 Antibody (NBP2-30914). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALG14 Antibody (NBP2-30914)

Discover more about diseases related to ALG14 Antibody (NBP2-30914).
 

Pathways for ALG14 Antibody (NBP2-30914)

View related products by pathway.

PTMs for ALG14 Antibody (NBP2-30914)

Learn more about PTMs related to ALG14 Antibody (NBP2-30914).

Blogs on ALG14

There are no specific blogs for ALG14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALG14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALG14
Uniprot