ALDH6A1 Antibody


Western Blot: ALDH6A1 Antibody [NBP1-82637] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637] - Staining of human tonsil shows low expression as expected.
Western Blot: ALDH6A1 Antibody [NBP1-82637] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637] - Staining of human liver shows strong cytoplasmic positivity with a granular pattern in hepatocytes.
Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637] - Staining in human liver and tonsil tissues using anti-ALDH6A1 antibody. Corresponding ALDH6A1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ALDH6A1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIAKLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMPSIT
Specificity of human, mouse, rat ALDH6A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ALDH6A1 Protein (NBP1-82637PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ALDH6A1 Antibody

  • aldehyde dehydrogenase 6 family, member A1
  • Aldehyde dehydrogenase family 6 member A1
  • EC
  • EC
  • Malonate-semialdehyde dehydrogenase [acylating]
  • malonate-semialdehyde dehydrogenase
  • methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
  • MGC40271
  • MMSDHmitochondrial acylating methylmalonate-semialdehyde dehydrogenase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ALDH6A1 Antibody (NBP1-82637) (0)

There are no publications for ALDH6A1 Antibody (NBP1-82637).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH6A1 Antibody (NBP1-82637) (0)

There are no reviews for ALDH6A1 Antibody (NBP1-82637). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALDH6A1 Antibody (NBP1-82637) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ALDH6A1 Products

Bioinformatics Tool for ALDH6A1 Antibody (NBP1-82637)

Discover related pathways, diseases and genes to ALDH6A1 Antibody (NBP1-82637). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH6A1 Antibody (NBP1-82637)

Discover more about diseases related to ALDH6A1 Antibody (NBP1-82637).

Pathways for ALDH6A1 Antibody (NBP1-82637)

View related products by pathway.

Blogs on ALDH6A1

There are no specific blogs for ALDH6A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ALDH6A1 Antibody and receive a gift card or discount.


Gene Symbol ALDH6A1