Recombinant Human ALDH1L1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ALDH1L1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 803-902 of Human ALDH1L1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ALDH1L1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ALDH1L1 GST (N-Term) Protein

  • 10-formyltetrahydrofolate dehydrogenase
  • aldehyde dehydrogenase 1 family, member L1
  • aldehyde dehydrogenase family 1 member L1
  • Cytosolic 10-formyltetrahydrofolate dehydrogenase
  • DKFZp781N0997
  • EC 1.5.1.6,10-FTHFDH
  • FDH
  • formyltetrahydrofolate dehydrogenase
  • FTHFD10-fTHF

Background

ALDH1L1 - aldehyde dehydrogenase 1 family, member L1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49350
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81935
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90906
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NBP2-67635
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IP
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
H00010840-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ALDH1L1 Partial Recombinant Protein (H00010840-Q01) (0)

There are no publications for ALDH1L1 Partial Recombinant Protein (H00010840-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH1L1 Partial Recombinant Protein (H00010840-Q01) (0)

There are no reviews for ALDH1L1 Partial Recombinant Protein (H00010840-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALDH1L1 Partial Recombinant Protein (H00010840-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional ALDH1L1 Products

Bioinformatics Tool for ALDH1L1 Partial Recombinant Protein (H00010840-Q01)

Discover related pathways, diseases and genes to ALDH1L1 Partial Recombinant Protein (H00010840-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH1L1 Partial Recombinant Protein (H00010840-Q01)

Discover more about diseases related to ALDH1L1 Partial Recombinant Protein (H00010840-Q01).
 

Pathways for ALDH1L1 Partial Recombinant Protein (H00010840-Q01)

View related products by pathway.

PTMs for ALDH1L1 Partial Recombinant Protein (H00010840-Q01)

Learn more about PTMs related to ALDH1L1 Partial Recombinant Protein (H00010840-Q01).

Blogs on ALDH1L1

There are no specific blogs for ALDH1L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ALDH1L1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH1L1