Recombinant Human ALDH1L1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ALDH1L1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 803-902 of Human ALDH1L1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ALDH1L1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ALDH1L1 Protein

  • 10-formyltetrahydrofolate dehydrogenase
  • aldehyde dehydrogenase 1 family, member L1
  • aldehyde dehydrogenase family 1 member L1
  • Cytosolic 10-formyltetrahydrofolate dehydrogenase
  • DKFZp781N0997
  • EC 1.5.1.6,10-FTHFDH
  • FDH
  • formyltetrahydrofolate dehydrogenase
  • FTHFD10-fTHF

Background

ALDH1L1 - aldehyde dehydrogenase 1 family, member L1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30636
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81935
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
H00010840-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ALDH1L1 Partial Recombinant Protein (H00010840-Q01) (0)

There are no publications for ALDH1L1 Partial Recombinant Protein (H00010840-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH1L1 Partial Recombinant Protein (H00010840-Q01) (0)

There are no reviews for ALDH1L1 Partial Recombinant Protein (H00010840-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALDH1L1 Partial Recombinant Protein (H00010840-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALDH1L1 Products

Bioinformatics Tool for ALDH1L1 Partial Recombinant Protein (H00010840-Q01)

Discover related pathways, diseases and genes to ALDH1L1 Partial Recombinant Protein (H00010840-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH1L1 Partial Recombinant Protein (H00010840-Q01)

Discover more about diseases related to ALDH1L1 Partial Recombinant Protein (H00010840-Q01).
 

Pathways for ALDH1L1 Partial Recombinant Protein (H00010840-Q01)

View related products by pathway.

PTMs for ALDH1L1 Partial Recombinant Protein (H00010840-Q01)

Learn more about PTMs related to ALDH1L1 Partial Recombinant Protein (H00010840-Q01).

Blogs on ALDH1L1

There are no specific blogs for ALDH1L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ALDH1L1 Antibody
NBP2-25143SS
Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ALDH1L1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH1L1