ALDH16A1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALDH16A1. Peptide sequence: YGPVPESHACALAWLDTQDRCLGHYVNGKWLKPEHRNSVPCQDPITGENL The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ALDH16A1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ALDH16A1 Antibody - BSA Free
Background
The ALDH16A1 gene encodes a member of the aldehyde dehydrogenases superfamily. The family members act on aldehyde substratesand use nicotinamide adenine dinucleotide phosphate (NADP) as a cofactor. This gene is conserved in chimpanzee, dog,cow, mouse, rat, and ze
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: Flow, ICC, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Publications for ALDH16A1 Antibody (NBP2-86974) (0)
There are no publications for ALDH16A1 Antibody (NBP2-86974).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ALDH16A1 Antibody (NBP2-86974) (0)
There are no reviews for ALDH16A1 Antibody (NBP2-86974).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ALDH16A1 Antibody (NBP2-86974) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ALDH16A1 Products
Research Areas for ALDH16A1 Antibody (NBP2-86974)
Find related products by research area.
|
Blogs on ALDH16A1