alcohol dehydrogenase 5 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

alcohol dehydrogenase 5 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADH5.
  
  

  Source: E. coli

  Amino Acid Sequence: DYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ADH5
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30636.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for alcohol dehydrogenase 5 Recombinant Protein Antigen

• ADH-3
• ADHXEC 1.1.1.1
• alcohol dehydrogenase (class III), chi polypeptide
• alcohol dehydrogenase 5 (class III), chi polypeptide
• Alcohol dehydrogenase 5
• Alcohol dehydrogenase class chi chain
• alcohol dehydrogenase class-3
• Alcohol dehydrogenase class-III
• EC 1.1.1
• EC 1.1.1.-
• EC 1.1.1.284
• FALDH
• FDHGSNOR
• formaldehyde dehydrogenase
• Glutathione-dependent formaldehyde dehydrogenase
• GSH-FDH
• S-(hydroxymethyl)glutathione dehydrogenase

Background

The ADH5 gene encodes glutathione dependent formaldehyde dehydrogenase or class III alcohol dehydrogenase chi subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, retinol, ethanol and other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class III alcohol dehydrogenase is a homodimer composed of 2 chi subunits. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long chain primary alcohols and for oxidation of S hydroxymethyl glutathione, a spontaneous adduct between formaldehyde and glutathione. The enzyme is an important component of cellular metabolism for the elimination of formaldehyde, which is a potent irritant and sensitizing agent that causes rhinitis, lacrymation, contact dermatitis and pharyngitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ADH5