Reactivity | HuSpecies Glossary |
Concentration | LYOPH |
Immunogen | Functions as a TCL1 PH decoy by binding to Akt. |
Specificity | The Akt (Isoforms 1,2,3) inhibitory peptide also contains a protein transduction (PTD) sequence (DRQIKIWFQNRRMKWKK) derived from antennapedia which renders the peptide cell permeable. The control peptide consists of only the PTD sequence. |
Preparation Method |
Preparation of 5 mM Stock Solutions PBS* is added directly to the vials to prepare the stock solutions. Note: Bring the solution to room temperature and quick spin the tubes before opening the caps. Akt (Isoforms 1,2,3) Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF Add 47.6 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing. Control Peptide: 1 mg of DRQIKIWFQNRRMKWKK Add 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing. Recipe for 1X PBS: 1. Dissolve the following in 800ml distilled H2O. -8g of NaCl -0.2g of KCl -1.44g of Na2HPO4 -0.24g of KH2PO4 2. Adjust pH to 7.5 with HCl. 3. Adjust volume to 1L with additional distilled H2O. 4. Sterilize by autoclaving |
Content | Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214.
Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 |
Gene | AKT1 |
Application Notes | Inhibition of Akt kinase activity. The inhibitor peptide is to block Akt1, Akt2, and Akt3 kinase activity. Optimal peptide concentrations and incubation times vary between model systems and should be determined empirically by users. A 100 uM final concentration may be a useful starting point. Please refer to Hiromura et al (2004) for additional information about how the inhibitor peptide has been used to block Ak1, Akt2 and Akt3 kinase activity. |
|
Reviewed Applications |
|
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | Solubilize the peptides prior to use by making 5 mM PBS* stock solutions (please see Preparation of 5 mM Stock Solutions under Preparation Method). |
Concentration | LYOPH |
Reconstitution Instructions | Please contact technical support for detailed reconstitution instructions. |
Images | Ratings | Applications | Species | Date | Details | ||||||
---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Ronald Miller |
WB | Human | 12/12/2014 |
Summary
|
Research Areas for AKT1/2/3 Inhibitor (NBP2-29332)Find related products by research area.
|
Gene Symbol | AKT1 |