AKT1/2/3 Inhibitor Peptide Set


There are currently no images for AKT1/2/3 Inhibitor (NBP2-29332).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Reactivity HuSpecies Glossary

Order Details

AKT1/2/3 Inhibitor Peptide Set Summary

Functions as a TCL1 PH decoy by binding to Akt.
The Akt (Isoforms 1,2,3) inhibitory peptide also contains a protein transduction (PTD) sequence (DRQIKIWFQNRRMKWKK) derived from antennapedia which renders the peptide cell permeable.

The control peptide consists of only the PTD sequence.
Preparation of 5 mM Stock Solutions
PBS* is added directly to the vials to prepare the stock solutions.
Note: Bring the solution to room temperature and quick spin the tubes before opening the caps. Akt (Isoforms 1,2,3) Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF Add 47.6 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing.

Control Peptide: 1 mg of DRQIKIWFQNRRMKWKK Add 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing.
Recipe for 1X PBS:
1. Dissolve the following in 800ml distilled H2O.
-8g of NaCl
-0.2g of KCl
-1.44g of Na2HPO4
-0.24g of KH2PO4
2. Adjust pH to 7.5 with HCl.
3. Adjust volume to 1L with additional distilled H2O.
4. Sterilize by autoclaving
Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361


Application Notes
Inhibition of Akt kinase activity.
The inhibitor peptide is to block Akt1, Akt2, and Akt3 kinase activity. Optimal peptide concentrations and incubation times vary between model systems and should be determined empirically by users. A 100 uM final concentration may be a useful starting point.

Please refer to Hiromura et al (2004) for additional information about how the inhibitor peptide has been used to block Ak1, Akt2 and Akt3 kinase activity.
Reviewed Applications
Read 1 Review rated 4
NBP2-29332 in the following application:

Read Publications using
NBP2-29332 in the following applications:

Reactivity Notes


Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Solubilize the peptides prior to use by making 5 mM PBS* stock solutions (please see Preparation of 5 mM Stock Solutions under Preparation Method).
Reconstitution Instructions
Please contact technical support for detailed reconstitution instructions.

Alternate Names for AKT1/2/3 Inhibitor Peptide Set

  • AKT
  • EC 2.7.11
  • EC
  • PKBMGC99656
  • Protein kinase B
  • Proto-oncogene c-Akt
  • rac protein kinase alpha
  • RAC-alpha serine/threonine-protein kinase
  • RAC-PK-alpha
  • v-akt murine thymoma viral oncogene homolog 1


Akt is a protein kinase that plays a central role in inhibiting apoptosis through promoting cell survival. Activated Akt functions by phosphorylating downstream targets in survival signaling pathways. TCL1 (a proto-oncogene underlying human T cell prolymphocytic leukemia) interacts with Akt through an Nterminal pleckstrin homology (PH) domain and functions as an Akt kinase co-activator. This inhibitory peptide contains a sequence (AVTDHPDRLWAWEKF) corresponding to the A strand of human TCL1 that interacts with Akt. 1 The peptide binds to the PH domain of Akt and inhibits Akt1, Akt2, and Akt3 kinase activity.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Inhibitors are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow, KO
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
Supplier Logo

Publications for AKT1/2/3 Inhibitor (NBP2-29332)(2)

Review for AKT1/2/3 Inhibitor (NBP2-29332) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-29332:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot AKT1/2/3 NBP2-29332
reviewed by:
Ronald Miller
WB Human 12/12/2014


ApplicationWestern Blot
Sample TestedCell lysate from HeLa cells


Blocking Details5% BSA in 1X PBS

Primary Anitbody

Dilution Ratio1:1000 in 1X PBS with troton X-100 (0.1%) at 4 degree O/N

Secondary Antibody

Secondary DescriptionGoat Anti-mouse IgG - HRP (Life Tech)
Secondary Manufacturer Cat#A24524
Secondary Concentration1:5K


Detection NotesECL, 1 min exposure with film


CommentsThe inhibitor works well but I would go for siRNA as it gives a better silencing.

Product General Protocols

View specific protocols for AKT1/2/3 Inhibitor (NBP2-29332): Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AKT1/2/3 Inhibitor (NBP2-29332) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats


Additional AKT1/2/3 Products

Array NBP2-29332

Bioinformatics Tool for AKT1/2/3 Inhibitor (NBP2-29332)

Discover related pathways, diseases and genes to AKT1/2/3 Inhibitor (NBP2-29332). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKT1/2/3 Inhibitor (NBP2-29332)

Discover more about diseases related to AKT1/2/3 Inhibitor (NBP2-29332).

Pathways for AKT1/2/3 Inhibitor (NBP2-29332)

View related products by pathway.

PTMs for AKT1/2/3 Inhibitor (NBP2-29332)

Learn more about PTMs related to AKT1/2/3 Inhibitor (NBP2-29332).

Research Areas for AKT1/2/3 Inhibitor (NBP2-29332)

Find related products by research area.

Blogs on AKT1/2/3

There are no specific blogs for AKT1/2/3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Recent Reviews


Ronald Miller
Application: WB
Species: Human


Gene Symbol AKT1