Recombinant Human AKAP13 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AKAP13 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human AKAP13 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQ

Protein/Peptide Type
Partial Recombinant Protein
Gene
AKAP13

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AKAP13 Protein

  • A kinase (PRKA) anchor protein 13
  • AKAP-LbcAKAP-13
  • A-kinase anchor protein 13
  • A-kinase anchoring protein
  • ARHGEF13
  • Breast cancer nuclear receptor-binding auxiliary protein
  • BRXNon-oncogenic Rho GTPase-specific GTP exchange factor
  • c-lbc
  • FLJ11952
  • FLJ43341
  • Guanine nucleotide exchange factor Lbc
  • HA-3
  • HT31
  • Human thyroid-anchoring protein 31
  • LBCLBC oncogene
  • Lymphoid blast crisis oncogeneProtein kinase A-anchoring protein 13
  • p47
  • PROTO-LB
  • PROTO-LBC

Background

AKAP13 - A kinase (PRKA) anchor protein 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
AF3795
Species: Hu
Applications: WB, IP
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC

Publications for AKAP13 Partial Recombinant Protein (H00011214-Q01) (0)

There are no publications for AKAP13 Partial Recombinant Protein (H00011214-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKAP13 Partial Recombinant Protein (H00011214-Q01) (0)

There are no reviews for AKAP13 Partial Recombinant Protein (H00011214-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AKAP13 Partial Recombinant Protein (H00011214-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AKAP13 Products

Bioinformatics Tool for AKAP13 Partial Recombinant Protein (H00011214-Q01)

Discover related pathways, diseases and genes to AKAP13 Partial Recombinant Protein (H00011214-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKAP13 Partial Recombinant Protein (H00011214-Q01)

Discover more about diseases related to AKAP13 Partial Recombinant Protein (H00011214-Q01).
 

Pathways for AKAP13 Partial Recombinant Protein (H00011214-Q01)

View related products by pathway.

PTMs for AKAP13 Partial Recombinant Protein (H00011214-Q01)

Learn more about PTMs related to AKAP13 Partial Recombinant Protein (H00011214-Q01).
 

Research Areas for AKAP13 Partial Recombinant Protein (H00011214-Q01)

Find related products by research area.

Blogs on AKAP13

There are no specific blogs for AKAP13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

AKAP13 Antibody (3D6)
H00011214-M10

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AKAP13 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP13