Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to TMPRSS11D(transmembrane protease, serine 11D) The peptide sequence was selected form the middle region of TMPRSS11D. Peptide sequence IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TMPRSS11D |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody - BSA Free
Background
TMPRSS11D is a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions. This gene encodes a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Publications for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody (NBP1-62546) (0)
There are no publications for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody (NBP1-62546).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody (NBP1-62546) (0)
There are no reviews for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody (NBP1-62546).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody (NBP1-62546) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Airway Trypsin-like Protease/HAT/TMPRSS11D Products
Blogs on Airway Trypsin-like Protease/HAT/TMPRSS11D