Recombinant Human AIP/ARA9 Protein

Product Discontinued

Recombinant Human AIP/ARA9 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acids 156-249 of Human AIP partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:KVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYE

• Preparation Method: in vitro wheat germ expression system
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: AIP

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AIP/ARA9 Protein

• ARA9
• FKBP16
• FKBP37
• SMTPHN
• XAP2
• XAP-2

Background

AIP may play a positive role in AHR-mediated signalling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AIP