AICL Antibody (1A2)

Images

 
There are currently no images for AICL Antibody (H00009976-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1A2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AICL Antibody (1A2) Summary

Immunogen
CLEC2B (AAH05254, 1 a.a. ~ 149 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEETNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICKKRIH
Specificity
Reacts with C-type lectin domain family 2, member B.
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CLEC2B
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AICL Antibody (1A2)

  • Activation-induced C-type lectin
  • AICL
  • AICLC-type lectin superfamily member 2
  • CLEC2B
  • CLEC-2B
  • CLECSF2
  • CLECSF2IFN-alpha-2b-inducing-related protein 1
  • C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 2 (activation-induced)
  • C-type lectin domain family 2 member B
  • C-type lectin domain family 2, member B
  • HP10085
  • IFN-alpha2b-inducing related protein 1
  • IFNRG1

Background

This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell activation antigen. An alternative splice variant has been described but its full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1718
Species: Hu, Mu, Rt
Applications: WB
AF3244
Species: Mu
Applications: IHC, WB
AF1900
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF1058
Species: Ca, Hu, Mu
Applications: WB
NBP2-14845
Species: Hu
Applications: IHC, IHC-P, WB
H00029121-M01
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB139
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
NBP1-32945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-25236
Species: Hu
Applications: IHC, IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-45041
Species: Hu, Po
Applications: Flow, ICC/IF, IF
7268-CT
Species: Hu
Applications: BA
MAB1059
Species: Hu
Applications: CyTOF-ready, Flow
MAB2238
Species: Hu
Applications: AgAct, CyTOF-reported, Flow
MAB6758
Species: Mu
Applications: CyTOF-ready, Flow, ICC
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
H00009976-M02
Species: Hu
Applications: ELISA

Publications for AICL Antibody (H00009976-M02) (0)

There are no publications for AICL Antibody (H00009976-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AICL Antibody (H00009976-M02) (0)

There are no reviews for AICL Antibody (H00009976-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AICL Antibody (H00009976-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AICL Products

Bioinformatics Tool for AICL Antibody (H00009976-M02)

Discover related pathways, diseases and genes to AICL Antibody (H00009976-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AICL Antibody (H00009976-M02)

Discover more about diseases related to AICL Antibody (H00009976-M02).
 

Pathways for AICL Antibody (H00009976-M02)

View related products by pathway.

PTMs for AICL Antibody (H00009976-M02)

Learn more about PTMs related to AICL Antibody (H00009976-M02).

Blogs on AICL

There are no specific blogs for AICL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AICL Antibody (1A2) and receive a gift card or discount.

Bioinformatics

Gene Symbol CLEC2B
Entrez
Uniprot